BLASTX nr result
ID: Akebia22_contig00032999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00032999 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006477898.1| PREDICTED: probable leucine-rich repeat rece... 76 6e-12 ref|XP_002524511.1| ATP binding protein, putative [Ricinus commu... 67 2e-09 ref|XP_006442309.1| hypothetical protein CICLE_v10023990mg, part... 65 1e-08 ref|XP_002283578.2| PREDICTED: probable leucine-rich repeat rece... 65 1e-08 ref|XP_003634703.1| PREDICTED: probable leucine-rich repeat rece... 65 1e-08 emb|CBI20121.3| unnamed protein product [Vitis vinifera] 65 1e-08 emb|CAN74151.1| hypothetical protein VITISV_028028 [Vitis vinifera] 65 1e-08 ref|XP_007021935.1| Leucine-rich repeat transmembrane protein ki... 64 2e-08 ref|XP_006370080.1| hypothetical protein POPTR_0001s39360g [Popu... 64 3e-08 ref|XP_002283596.2| PREDICTED: probable leucine-rich repeat rece... 63 4e-08 emb|CAN76710.1| hypothetical protein VITISV_022377 [Vitis vinifera] 63 4e-08 gb|EXB54091.1| hypothetical protein L484_017528 [Morus notabilis] 61 1e-07 ref|XP_004295665.1| PREDICTED: probable leucine-rich repeat rece... 61 2e-07 ref|XP_003628432.1| hypothetical protein MTR_8g058070 [Medicago ... 61 2e-07 ref|XP_003628428.1| Leucine-rich repeat family protein /protein ... 61 2e-07 ref|XP_003616753.1| Cysteine-rich receptor-like protein kinase [... 61 2e-07 emb|CBI20127.3| unnamed protein product [Vitis vinifera] 60 4e-07 gb|EYU38244.1| hypothetical protein MIMGU_mgv11b008016mg [Mimulu... 59 5e-07 ref|XP_004491065.1| PREDICTED: probable leucine-rich repeat rece... 59 7e-07 ref|XP_002524514.1| ATP binding protein, putative [Ricinus commu... 59 7e-07 >ref|XP_006477898.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Citrus sinensis] Length = 97 Score = 75.9 bits (185), Expect = 6e-12 Identities = 40/60 (66%), Positives = 46/60 (76%), Gaps = 1/60 (1%) Frame = +1 Query: 127 LALGETTLVQSEVDTLKQIAKTLGKK-WNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 LA G TL QSEV+ LK IAKTLGK+ WNFSVDPCS +EGW D+NPV E+ VTCNC+ Sbjct: 22 LAFG-ATLPQSEVEALKDIAKTLGKRNWNFSVDPCSGKEGWA-DQNPVKGFENAVTCNCS 79 >ref|XP_002524511.1| ATP binding protein, putative [Ricinus communis] gi|223536185|gb|EEF37838.1| ATP binding protein, putative [Ricinus communis] Length = 985 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/59 (55%), Positives = 37/59 (62%) Frame = +1 Query: 127 LALGETTLVQSEVDTLKQIAKTLGKKWNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 LA G L EV+ LK I KTLGK WNF+VDPCS GW NPV E+ VTCNC+ Sbjct: 20 LASGAARLPNDEVEALKDIGKTLGKTWNFTVDPCSGDSGWT-TPNPVKGFENAVTCNCS 77 >ref|XP_006442309.1| hypothetical protein CICLE_v10023990mg, partial [Citrus clementina] gi|557544571|gb|ESR55549.1| hypothetical protein CICLE_v10023990mg, partial [Citrus clementina] Length = 90 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/54 (61%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = +1 Query: 145 TLVQSEVDTLKQIAKTLGKK-WNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 TL EV LK IA TLGK+ WNFS DPCS +EGW D+NP E+ VTCNCT Sbjct: 10 TLPYDEVRALKDIANTLGKRNWNFSADPCSGKEGWA-DQNPDKGFENAVTCNCT 62 >ref|XP_002283578.2| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Vitis vinifera] Length = 1011 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +1 Query: 127 LALGETTLVQSEVDTLKQIAKTLGK-KWNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 L T L +EV+ L++IAKTLGK WNFS DPC GW KNPV SE+ VTC+CT Sbjct: 21 LTFSATLLPNNEVEALEEIAKTLGKTDWNFSADPCGGEWGWA-TKNPVKGSENAVTCSCT 79 >ref|XP_003634703.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Vitis vinifera] Length = 1007 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +1 Query: 127 LALGETTLVQSEVDTLKQIAKTLGK-KWNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 L T L +EV+ L++IAKTLGK WNFS DPC GW KNPV SE+ VTC+CT Sbjct: 21 LTFSATLLPNNEVEALEEIAKTLGKTDWNFSADPCGGEWGWA-TKNPVKGSENAVTCSCT 79 >emb|CBI20121.3| unnamed protein product [Vitis vinifera] Length = 869 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +1 Query: 127 LALGETTLVQSEVDTLKQIAKTLGK-KWNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 L T L +EV+ L++IAKTLGK WNFS DPC GW KNPV SE+ VTC+CT Sbjct: 21 LTFSATLLPNNEVEALEEIAKTLGKTDWNFSADPCGGEWGWA-TKNPVKGSENAVTCSCT 79 >emb|CAN74151.1| hypothetical protein VITISV_028028 [Vitis vinifera] Length = 882 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +1 Query: 127 LALGETTLVQSEVDTLKQIAKTLGK-KWNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 L T L +EV+ L++IAKTLGK WNFS DPC GW KNPV SE+ VTC+CT Sbjct: 21 LTFSATLLPNNEVEALEEIAKTLGKTDWNFSADPCGGEWGWA-TKNPVKGSENAVTCSCT 79 >ref|XP_007021935.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao] gi|508721563|gb|EOY13460.1| Leucine-rich repeat transmembrane protein kinase [Theobroma cacao] Length = 1016 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/54 (61%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = +1 Query: 145 TLVQSEVDTLKQIAKTLGK-KWNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 TL EV L+ IAKTLGK WNFSVDPCS EGW NPV E+ VTCNC+ Sbjct: 25 TLPDDEVQYLRDIAKTLGKTNWNFSVDPCSGEEGWA-TANPVKGFENAVTCNCS 77 >ref|XP_006370080.1| hypothetical protein POPTR_0001s39360g [Populus trichocarpa] gi|550349259|gb|ERP66649.1| hypothetical protein POPTR_0001s39360g [Populus trichocarpa] Length = 1005 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/59 (52%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = +1 Query: 130 ALGETTLVQSEVDTLKQIAKTLGK-KWNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 A G T L EV+ L+ +AKT+GK WNFS DPC + GWV D NPV +E+ V+C+CT Sbjct: 20 ASGATRLPDDEVEALRDMAKTIGKTNWNFSADPCGGQWGWV-DPNPVKGNENAVSCDCT 77 >ref|XP_002283596.2| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Vitis vinifera] Length = 1007 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +1 Query: 127 LALGETTLVQSEVDTLKQIAKTLGKK-WNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 L T L +EV+ L++IA+TLGK WNFS DPC GW KNPV SE+ VTC+CT Sbjct: 21 LTFSATLLPNNEVEALEEIAETLGKTDWNFSADPCGGEWGWA-TKNPVKGSENAVTCSCT 79 >emb|CAN76710.1| hypothetical protein VITISV_022377 [Vitis vinifera] Length = 377 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +1 Query: 127 LALGETTLVQSEVDTLKQIAKTLGKK-WNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 L T L +EV+ L++IA+TLGK WNFS DPC GW KNPV SE+ VTC+CT Sbjct: 21 LTFSATLLPNNEVEALEEIAETLGKTDWNFSADPCGGEWGWA-TKNPVKGSENAVTCSCT 79 >gb|EXB54091.1| hypothetical protein L484_017528 [Morus notabilis] Length = 772 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/51 (62%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = +1 Query: 148 LVQSEVDTLKQIAKTLGK-KWNFSVDPCSKREGWVLDKNPVTESESNVTCN 297 L +SEV+ L++IAKTLGK WNFSVDPCS GWV KNPV E+ V+CN Sbjct: 31 LPKSEVEALREIAKTLGKTNWNFSVDPCSGDYGWV-TKNPVQGFENAVSCN 80 >ref|XP_004295665.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Fragaria vesca subsp. vesca] Length = 1979 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/59 (49%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = +1 Query: 130 ALGETTLVQSEVDTLKQIAKTLGKKWNFSVDPCSKREGWVLDKNPVTESESNVTC-NCT 303 A G L E+ L+ I +TLGK WNFSVDPCS +GW+ PV + +NVTC NC+ Sbjct: 24 AFGANRLSADEIQALRDIGETLGKSWNFSVDPCSGEQGWI--SAPVGQYMNNVTCGNCS 80 >ref|XP_003628432.1| hypothetical protein MTR_8g058070 [Medicago truncatula] gi|355522454|gb|AET02908.1| hypothetical protein MTR_8g058070 [Medicago truncatula] Length = 117 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/54 (55%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = +1 Query: 145 TLVQSEVDTLKQIAKTLGKK-WNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 TL + EV+ LK I KTLGKK W+FSVDPCS R W+ + SE+ VTCNC+ Sbjct: 27 TLQEDEVEALKDIGKTLGKKDWDFSVDPCSGRNNWI-SSTQLHGSENAVTCNCS 79 >ref|XP_003628428.1| Leucine-rich repeat family protein /protein kinase family protein-like protein [Medicago truncatula] gi|355522450|gb|AET02904.1| Leucine-rich repeat family protein /protein kinase family protein-like protein [Medicago truncatula] Length = 116 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/54 (55%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = +1 Query: 145 TLVQSEVDTLKQIAKTLGKK-WNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 TL + EV+ LK I KTLGKK W+FSVDPCS R W+ + SE+ VTCNC+ Sbjct: 27 TLQEDEVEALKDIGKTLGKKDWDFSVDPCSGRNNWI-SSTQLHGSENAVTCNCS 79 >ref|XP_003616753.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] gi|355518088|gb|AES99711.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula] Length = 996 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/54 (59%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = +1 Query: 145 TLVQSEVDTLKQIAKTLGKK-WNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 TL + EV+ LK IAKTLGKK W+FSVDPCS W V SE+ VTCNCT Sbjct: 27 TLSKDEVEVLKDIAKTLGKKDWDFSVDPCSGERNWT-SSVQVKGSENAVTCNCT 79 >emb|CBI20127.3| unnamed protein product [Vitis vinifera] Length = 906 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = +1 Query: 148 LVQSEVDTLKQIAKTLGKK-WNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 L+ V+ L++IAKTLGK WNFS DPC GW KNPV SE+ VTC+CT Sbjct: 28 LLHFTVEALEEIAKTLGKTDWNFSADPCGGEWGWA-TKNPVKGSENAVTCSCT 79 >gb|EYU38244.1| hypothetical protein MIMGU_mgv11b008016mg [Mimulus guttatus] Length = 334 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (1%) Frame = +1 Query: 130 ALGETTLVQSEVDTLKQIAKTLGKK-WNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 A G L EV +L+ +AK+LGK WNFSVDPCS GWV+ + E E+ +TC+CT Sbjct: 16 ASGAALLPPDEVISLQVVAKSLGKTDWNFSVDPCSGLSGWVILNPAIKEFENTLTCDCT 74 >ref|XP_004491065.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Cicer arietinum] Length = 760 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/60 (55%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +1 Query: 127 LALGETTLVQSEVDTLKQIAKTLGKK-WNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 LA G TL + EV+ LK IA TLGKK W+FSVDPCS + W V SE+ VTCNC+ Sbjct: 22 LAFG-ATLSKDEVEALKDIANTLGKKDWDFSVDPCSGEQNWT-SSVQVKGSENAVTCNCS 79 >ref|XP_002524514.1| ATP binding protein, putative [Ricinus communis] gi|223536188|gb|EEF37841.1| ATP binding protein, putative [Ricinus communis] Length = 1007 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/60 (50%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +1 Query: 127 LALGETTLVQSEVDTLKQIAKTLGKK-WNFSVDPCSKREGWVLDKNPVTESESNVTCNCT 303 LA G TL EV+ L+ IA TLGK W+F+VDPCS + GW +T E+NVTC+C+ Sbjct: 19 LAFG-ATLPDDEVEALRGIANTLGKNDWDFNVDPCSGKPGWTDPAQELTGIENNVTCDCS 77