BLASTX nr result
ID: Akebia22_contig00032854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00032854 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265908.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosph... 55 8e-06 >ref|XP_002265908.1| PREDICTED: pyridoxine/pyridoxamine 5'-phosphate oxidase [Vitis vinifera] gi|297745497|emb|CBI40577.3| unnamed protein product [Vitis vinifera] Length = 197 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 318 QVDYLNLKSNERLSFKSKRSGDGGKCWISEKLNP 217 QVDYLNLK+NERL+F S ++ DG KCW SEK+NP Sbjct: 164 QVDYLNLKNNERLTFTSSKNVDGVKCWNSEKINP 197