BLASTX nr result
ID: Akebia22_contig00032839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00032839 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214915.1| hypothetical protein PRUPE_ppa000707mg [Prun... 60 4e-07 ref|XP_002321075.2| glycosyl hydrolase family 38 family protein ... 55 8e-06 >ref|XP_007214915.1| hypothetical protein PRUPE_ppa000707mg [Prunus persica] gi|462411065|gb|EMJ16114.1| hypothetical protein PRUPE_ppa000707mg [Prunus persica] Length = 1027 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -3 Query: 269 KVTRGGPVDPVKLLVELSPMEIRTFVIDFEYIFL 168 KV RGGPVDP KLLVEL+PMEIRTF+IDF+Y+ + Sbjct: 991 KVVRGGPVDPAKLLVELAPMEIRTFLIDFDYLHM 1024 >ref|XP_002321075.2| glycosyl hydrolase family 38 family protein [Populus trichocarpa] gi|550324167|gb|EEE99390.2| glycosyl hydrolase family 38 family protein [Populus trichocarpa] Length = 1009 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 266 VTRGGPVDPVKLLVELSPMEIRTFVIDFEYIF 171 V RGGPVDP KL+VEL+PMEIRTFVIDF++ F Sbjct: 972 VLRGGPVDPAKLVVELAPMEIRTFVIDFDHQF 1003