BLASTX nr result
ID: Akebia22_contig00032835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00032835 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006850999.1| hypothetical protein AMTR_s00025p00216900 [A... 65 8e-09 ref|XP_004138532.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 65 8e-09 ref|XP_002513297.1| strubbelig receptor, putative [Ricinus commu... 65 8e-09 ref|XP_007217699.1| hypothetical protein PRUPE_ppa002458mg [Prun... 65 1e-08 ref|XP_002320001.2| leucine-rich repeat transmembrane protein ki... 65 1e-08 ref|XP_006488603.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 64 2e-08 ref|XP_006435523.1| hypothetical protein CICLE_v10010883mg, part... 64 2e-08 gb|EXB26124.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Morus notab... 64 3e-08 ref|XP_006586431.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 64 3e-08 ref|XP_003627481.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago... 63 4e-08 ref|XP_006845116.1| hypothetical protein AMTR_s00005p00184950 [A... 63 5e-08 ref|XP_006362102.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 62 8e-08 ref|XP_006836581.1| hypothetical protein AMTR_s00131p00083660 [A... 62 8e-08 ref|XP_004252624.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 62 8e-08 gb|ADB93024.1| leucine-rich repeat receptor-like protein kinase ... 62 1e-07 emb|CBI35784.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_002263152.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 62 1e-07 gb|EYU21256.1| hypothetical protein MIMGU_mgv1a002171mg [Mimulus... 61 1e-07 gb|EYU21255.1| hypothetical protein MIMGU_mgv1a002171mg [Mimulus... 61 1e-07 ref|XP_006604929.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 61 1e-07 >ref|XP_006850999.1| hypothetical protein AMTR_s00025p00216900 [Amborella trichopoda] gi|548854670|gb|ERN12580.1| hypothetical protein AMTR_s00025p00216900 [Amborella trichopoda] Length = 632 Score = 65.5 bits (158), Expect = 8e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKR 106 VIALCVQ E EFRPPMSEVVQALVRLVQRSSMNKR Sbjct: 570 VIALCVQPEPEFRPPMSEVVQALVRLVQRSSMNKR 604 >ref|XP_004138532.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cucumis sativus] gi|449496770|ref|XP_004160222.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Cucumis sativus] Length = 662 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKRED 112 +IALCVQSE EFRPPMSEVVQALV LVQRSSMN R+D Sbjct: 614 IIALCVQSEPEFRPPMSEVVQALVTLVQRSSMNMRDD 650 >ref|XP_002513297.1| strubbelig receptor, putative [Ricinus communis] gi|223547205|gb|EEF48700.1| strubbelig receptor, putative [Ricinus communis] Length = 694 Score = 65.5 bits (158), Expect = 8e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKRED 112 +IALCVQSE EFRPPMSEVVQALVRLVQRSSM R+D Sbjct: 646 IIALCVQSEPEFRPPMSEVVQALVRLVQRSSMKMRDD 682 >ref|XP_007217699.1| hypothetical protein PRUPE_ppa002458mg [Prunus persica] gi|462413849|gb|EMJ18898.1| hypothetical protein PRUPE_ppa002458mg [Prunus persica] Length = 670 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKRED 112 +IALCVQ E EFRPPMSEVVQ LVRLVQRSSMN RED Sbjct: 606 IIALCVQREPEFRPPMSEVVQQLVRLVQRSSMNMRED 642 >ref|XP_002320001.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|550322992|gb|EEE98316.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 681 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKRED 112 +IALC Q+E EFRPPMSEVVQALVRLVQRSSMN R+D Sbjct: 633 IIALCAQAEPEFRPPMSEVVQALVRLVQRSSMNLRDD 669 >ref|XP_006488603.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Citrus sinensis] Length = 696 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKRED 112 VIALCVQ E EFRPPMSEVV+ALVRLVQRSSMN ++D Sbjct: 648 VIALCVQPEPEFRPPMSEVVEALVRLVQRSSMNMKDD 684 >ref|XP_006435523.1| hypothetical protein CICLE_v10010883mg, partial [Citrus clementina] gi|557537649|gb|ESR48763.1| hypothetical protein CICLE_v10010883mg, partial [Citrus clementina] Length = 317 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKRED 112 VIALCVQ E EFRPPMSEVV+ALVRLVQRSSMN ++D Sbjct: 269 VIALCVQPEPEFRPPMSEVVEALVRLVQRSSMNMKDD 305 >gb|EXB26124.1| Protein STRUBBELIG-RECEPTOR FAMILY 5 [Morus notabilis] Length = 697 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKRED 112 +IALCVQ E EFRP MSEVVQALVRLVQRSSMNKR D Sbjct: 649 IIALCVQREPEFRPAMSEVVQALVRLVQRSSMNKRGD 685 >ref|XP_006586431.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 5-like [Glycine max] Length = 725 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKRED 112 ++ALCVQSE EFRPP+SE+VQALVRLVQRSSM RED Sbjct: 687 IVALCVQSEPEFRPPVSELVQALVRLVQRSSMTMRED 723 >ref|XP_003627481.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula] gi|355521503|gb|AET01957.1| Protein STRUBBELIG-RECEPTOR FAMILY [Medicago truncatula] Length = 716 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKR 106 VIALCVQSE EFRPPMSEVVQALVRLVQR++M+KR Sbjct: 661 VIALCVQSEPEFRPPMSEVVQALVRLVQRTNMSKR 695 >ref|XP_006845116.1| hypothetical protein AMTR_s00005p00184950 [Amborella trichopoda] gi|548847629|gb|ERN06791.1| hypothetical protein AMTR_s00005p00184950 [Amborella trichopoda] Length = 381 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKR 106 +IALCVQ E EFRPPMSEVVQALVRL+QR+SMNKR Sbjct: 325 IIALCVQPEPEFRPPMSEVVQALVRLMQRASMNKR 359 >ref|XP_006362102.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Solanum tuberosum] Length = 706 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKR 106 VIALCVQSE EFRPPMSEVV+ALVRLVQR++M+KR Sbjct: 653 VIALCVQSEPEFRPPMSEVVEALVRLVQRANMSKR 687 >ref|XP_006836581.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda] gi|548839120|gb|ERM99434.1| hypothetical protein AMTR_s00131p00083660 [Amborella trichopoda] Length = 721 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKR 106 V+ALCVQ E EFRPPMSEVVQALVRLVQR+SM+KR Sbjct: 665 VVALCVQPEPEFRPPMSEVVQALVRLVQRASMSKR 699 >ref|XP_004252624.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Solanum lycopersicum] Length = 706 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKR 106 VIALCVQSE EFRPPMSEVV+ALVRLVQR++M+KR Sbjct: 653 VIALCVQSEPEFRPPMSEVVEALVRLVQRANMSKR 687 >gb|ADB93024.1| leucine-rich repeat receptor-like protein kinase [Dendrobium nobile] Length = 255 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKR 106 VIALCVQ E EFRPPMSEVVQALVRLVQR+ MNK+ Sbjct: 195 VIALCVQPEPEFRPPMSEVVQALVRLVQRAKMNKK 229 >emb|CBI35784.3| unnamed protein product [Vitis vinifera] Length = 708 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKREDPN 118 VIALCVQ E EFRPPMSEVVQALVRLVQR++M+KR N Sbjct: 652 VIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTISN 690 >ref|XP_002263152.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform 2 [Vitis vinifera] Length = 686 Score = 61.6 bits (148), Expect = 1e-07 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKREDPN 118 VIALCVQ E EFRPPMSEVVQALVRLVQR++M+KR N Sbjct: 630 VIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKRTISN 668 >gb|EYU21256.1| hypothetical protein MIMGU_mgv1a002171mg [Mimulus guttatus] Length = 704 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKR 106 VIALCVQ E EFRPPMSEVVQALVRLVQR++M+KR Sbjct: 650 VIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKR 684 >gb|EYU21255.1| hypothetical protein MIMGU_mgv1a002171mg [Mimulus guttatus] Length = 705 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKR 106 VIALCVQ E EFRPPMSEVVQALVRLVQR++M+KR Sbjct: 651 VIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKR 685 >ref|XP_006604929.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like isoform X2 [Glycine max] Length = 708 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 2 VIALCVQSEQEFRPPMSEVVQALVRLVQRSSMNKR 106 VIALCVQ E EFRPPMSEVVQALVRLVQR++M+KR Sbjct: 652 VIALCVQPEPEFRPPMSEVVQALVRLVQRANMSKR 686