BLASTX nr result
ID: Akebia22_contig00032759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00032759 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20414.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_003527472.1| PREDICTED: G-type lectin S-receptor-like ser... 59 7e-07 ref|XP_007132606.1| hypothetical protein PHAVU_011G109100g [Phas... 57 3e-06 ref|XP_007132605.1| hypothetical protein PHAVU_011G109100g [Phas... 57 3e-06 emb|CBI35387.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_007149921.1| hypothetical protein PHAVU_005G110300g [Phas... 55 8e-06 ref|NP_001235152.1| S-locus lectin protein kinase family protein... 55 1e-05 >emb|CBI20414.3| unnamed protein product [Vitis vinifera] Length = 547 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/53 (56%), Positives = 38/53 (71%) Frame = +1 Query: 1 SAYAYGYRGCSMWDGDILNLVPLVDDHSAGGNLYLRLAASELPNSQGNTIPSS 159 SAY+Y + C++W GD+LNL L DD S G + YL+LAASEL N +GN I SS Sbjct: 128 SAYSYNVKECTVWGGDLLNLQQLSDDDSNGRDFYLKLAASEL-NGKGNKISSS 179 >ref|XP_003527472.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130-like [Glycine max] Length = 827 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = +1 Query: 1 SAYAYGYRGCSMWDGDILNLVPLVDDHSAGGNLYLRLAASELPNSQGN 144 +AYAY GCS+W+GD+LNL L D S+G L+LRLAASE +S+ N Sbjct: 393 TAYAYDNSGCSIWNGDLLNLQQLTQDDSSGQTLFLRLAASEFHDSKSN 440 >ref|XP_007132606.1| hypothetical protein PHAVU_011G109100g [Phaseolus vulgaris] gi|561005606|gb|ESW04600.1| hypothetical protein PHAVU_011G109100g [Phaseolus vulgaris] Length = 829 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 1 SAYAYGYRGCSMWDGDILNLVPLVDDHSAGGNLYLRLAASELPNSQGN 144 +AYAY GCS+W GD+LNL L D S+G L+L+LAASE +S+ N Sbjct: 394 TAYAYDNNGCSIWYGDLLNLQQLTQDDSSGQTLFLKLAASEFHDSKSN 441 >ref|XP_007132605.1| hypothetical protein PHAVU_011G109100g [Phaseolus vulgaris] gi|561005605|gb|ESW04599.1| hypothetical protein PHAVU_011G109100g [Phaseolus vulgaris] Length = 637 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/48 (54%), Positives = 34/48 (70%) Frame = +1 Query: 1 SAYAYGYRGCSMWDGDILNLVPLVDDHSAGGNLYLRLAASELPNSQGN 144 +AYAY GCS+W GD+LNL L D S+G L+L+LAASE +S+ N Sbjct: 202 TAYAYDNNGCSIWYGDLLNLQQLTQDDSSGQTLFLKLAASEFHDSKSN 249 >emb|CBI35387.3| unnamed protein product [Vitis vinifera] Length = 637 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +1 Query: 1 SAYAYGYRGCSMWDGDILNLVPLVDDHSAGGNLYLRLAASELPNSQGNTIPSS 159 SAY+Y C++W GD+LNL L DD+S G + YL+LAASEL + +GN I SS Sbjct: 189 SAYSYYMEKCTVWGGDLLNLQQLSDDNSNGQDFYLKLAASEL-SGKGNKISSS 240 >ref|XP_007149921.1| hypothetical protein PHAVU_005G110300g [Phaseolus vulgaris] gi|561023185|gb|ESW21915.1| hypothetical protein PHAVU_005G110300g [Phaseolus vulgaris] Length = 726 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +1 Query: 1 SAYAYGYRGCSMWDGDILNLVPLVDDHSAGGNLYLRLAASEL 126 +AYAY GCS+WDG++LN+ L D S+G LYL+LAASEL Sbjct: 336 TAYAYDSNGCSIWDGNLLNVQQLSSDDSSGETLYLKLAASEL 377 >ref|NP_001235152.1| S-locus lectin protein kinase family protein precursor [Glycine max] gi|223452430|gb|ACM89542.1| S-locus lectin protein kinase family protein [Glycine max] gi|223452558|gb|ACM89606.1| S-locus lectin protein kinase family protein [Glycine max] Length = 829 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/48 (52%), Positives = 33/48 (68%) Frame = +1 Query: 1 SAYAYGYRGCSMWDGDILNLVPLVDDHSAGGNLYLRLAASELPNSQGN 144 +AYA+ GCS+W GD+LNL L D ++G L+LRLAASE +S N Sbjct: 393 TAYAHDNSGCSIWHGDLLNLQQLTQDDNSGQTLFLRLAASEFDDSNSN 440