BLASTX nr result
ID: Akebia22_contig00032704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00032704 (209 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18827.1| hypothetical protein MIMGU_mgv1a022178mg, partial... 57 3e-06 ref|XP_006846781.1| hypothetical protein AMTR_s00148p00040560 [A... 56 6e-06 >gb|EYU18827.1| hypothetical protein MIMGU_mgv1a022178mg, partial [Mimulus guttatus] Length = 778 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +2 Query: 2 EDELHDRYHDLGALANNLSQSFRYNMYENDDVE 100 +D++HDR +D+ ALANNLSQ+FRYNMY+NDD E Sbjct: 495 DDDVHDRDYDVAALANNLSQAFRYNMYDNDDAE 527 >ref|XP_006846781.1| hypothetical protein AMTR_s00148p00040560 [Amborella trichopoda] gi|548849603|gb|ERN08362.1| hypothetical protein AMTR_s00148p00040560 [Amborella trichopoda] Length = 707 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +2 Query: 2 EDELHDRYHDLGALANNLSQSFRYNMYENDDVEEI 106 ED++ DR +D+ ALANNLSQ+FRY MYENDD EE+ Sbjct: 499 EDDIRDRDYDVAALANNLSQAFRYGMYENDDGEEV 533