BLASTX nr result
ID: Akebia22_contig00030752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00030752 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007017373.1| Serine protease inhibitor (SERPIN) family pr... 59 9e-07 ref|XP_006434870.1| hypothetical protein CICLE_v10001434mg [Citr... 58 2e-06 ref|XP_006473392.1| PREDICTED: serpin-ZX-like [Citrus sinensis] 56 5e-06 ref|XP_006354930.1| PREDICTED: serpin-ZX-like [Solanum tuberosum] 55 8e-06 >ref|XP_007017373.1| Serine protease inhibitor (SERPIN) family protein [Theobroma cacao] gi|508722701|gb|EOY14598.1| Serine protease inhibitor (SERPIN) family protein [Theobroma cacao] Length = 390 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 2 ANGVWIDESLPLKSCFKDIVDNVYKAAAKQVDF 100 ANGVWID+SLPLK FK +VDNVYKAA+ QVDF Sbjct: 95 ANGVWIDKSLPLKPSFKQVVDNVYKAASNQVDF 127 >ref|XP_006434870.1| hypothetical protein CICLE_v10001434mg [Citrus clementina] gi|557536992|gb|ESR48110.1| hypothetical protein CICLE_v10001434mg [Citrus clementina] Length = 391 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +2 Query: 2 ANGVWIDESLPLKSCFKDIVDNVYKAAAKQVDF 100 ANGVWIDESL LK+ FK +VDNVYKAA+ QVDF Sbjct: 95 ANGVWIDESLSLKNTFKQVVDNVYKAASNQVDF 127 >ref|XP_006473392.1| PREDICTED: serpin-ZX-like [Citrus sinensis] Length = 391 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +2 Query: 2 ANGVWIDESLPLKSCFKDIVDNVYKAAAKQVDF 100 ANGVWID+SL LK+ FK +VDNVYKAA+ QVDF Sbjct: 95 ANGVWIDKSLSLKNTFKQVVDNVYKAASNQVDF 127 >ref|XP_006354930.1| PREDICTED: serpin-ZX-like [Solanum tuberosum] Length = 390 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +2 Query: 2 ANGVWIDESLPLKSCFKDIVDNVYKAAAKQVDF 100 ANG+WID++LPLK FK +VDNVYKAA++ VDF Sbjct: 96 ANGIWIDQTLPLKPSFKQVVDNVYKAASEYVDF 128