BLASTX nr result
ID: Akebia22_contig00028385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00028385 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006846562.1| hypothetical protein AMTR_s00018p00222050 [A... 58 1e-06 gb|EXC25017.1| hypothetical protein L484_021887 [Morus notabilis] 57 3e-06 ref|XP_006283057.1| hypothetical protein CARUB_v10004057mg [Caps... 57 3e-06 ref|XP_002867676.1| hypothetical protein ARALYDRAFT_492440 [Arab... 57 4e-06 ref|XP_006581159.1| PREDICTED: dentin sialophosphoprotein-like i... 56 6e-06 ref|XP_006413463.1| hypothetical protein EUTSA_v10027094mg, part... 56 6e-06 ref|NP_194151.2| transcription elongation factor (TFIIS) family ... 55 8e-06 emb|CAB45055.1| hypothetical protein [Arabidopsis thaliana] gi|7... 55 8e-06 >ref|XP_006846562.1| hypothetical protein AMTR_s00018p00222050 [Amborella trichopoda] gi|548849372|gb|ERN08237.1| hypothetical protein AMTR_s00018p00222050 [Amborella trichopoda] Length = 1063 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 163 MMLEDFFTLTEMKDGLASVSRVEELISLMQKNKD 264 M LEDFFTLTEMKDGL+S+SRVEEL+S+MQ+ KD Sbjct: 1 MRLEDFFTLTEMKDGLSSLSRVEELVSVMQQEKD 34 >gb|EXC25017.1| hypothetical protein L484_021887 [Morus notabilis] Length = 978 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +1 Query: 163 MMLEDFFTLTEMKDGLASVSRVEELISLMQKNKD 264 M LEDFFTLTEMKDGL ++SRVEEL+++MQK KD Sbjct: 1 MTLEDFFTLTEMKDGLTALSRVEELVTVMQKEKD 34 >ref|XP_006283057.1| hypothetical protein CARUB_v10004057mg [Capsella rubella] gi|482551762|gb|EOA15955.1| hypothetical protein CARUB_v10004057mg [Capsella rubella] Length = 1002 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 163 MMLEDFFTLTEMKDGLASVSRVEELISLMQKNKD 264 M LEDFFTLTE+KDGLA SRVEEL+S+MQ NKD Sbjct: 1 MTLEDFFTLTEIKDGLAVTSRVEELVSVMQSNKD 34 >ref|XP_002867676.1| hypothetical protein ARALYDRAFT_492440 [Arabidopsis lyrata subsp. lyrata] gi|297313512|gb|EFH43935.1| hypothetical protein ARALYDRAFT_492440 [Arabidopsis lyrata subsp. lyrata] Length = 1002 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 163 MMLEDFFTLTEMKDGLASVSRVEELISLMQKNKD 264 M LEDFFTLTE+KDGL + SRVEEL+S+MQ NKD Sbjct: 1 MTLEDFFTLTEIKDGLTATSRVEELVSVMQSNKD 34 >ref|XP_006581159.1| PREDICTED: dentin sialophosphoprotein-like isoform X1 [Glycine max] gi|571458568|ref|XP_006581160.1| PREDICTED: dentin sialophosphoprotein-like isoform X2 [Glycine max] Length = 1002 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 163 MMLEDFFTLTEMKDGLASVSRVEELISLMQKNKD 264 M LEDFFTLTEMKDGL + SRV+EL+S+MQK KD Sbjct: 1 MTLEDFFTLTEMKDGLTAPSRVQELVSVMQKEKD 34 >ref|XP_006413463.1| hypothetical protein EUTSA_v10027094mg, partial [Eutrema salsugineum] gi|557114633|gb|ESQ54916.1| hypothetical protein EUTSA_v10027094mg, partial [Eutrema salsugineum] Length = 1003 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 163 MMLEDFFTLTEMKDGLASVSRVEELISLMQKNKD 264 M LEDFFTLTE+KDGLA+ RVEEL+S+MQ NKD Sbjct: 1 MTLEDFFTLTEIKDGLAATFRVEELVSVMQSNKD 34 >ref|NP_194151.2| transcription elongation factor (TFIIS) family protein [Arabidopsis thaliana] gi|17381116|gb|AAL36370.1| unknown protein [Arabidopsis thaliana] gi|20465607|gb|AAM20286.1| unknown protein [Arabidopsis thaliana] gi|332659463|gb|AEE84863.1| transcription elongation factor (TFIIS) family protein [Arabidopsis thaliana] Length = 1000 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 163 MMLEDFFTLTEMKDGLASVSRVEELISLMQKNKD 264 M LEDFFTLTE+KDGL SRVEEL+S+MQ NKD Sbjct: 1 MTLEDFFTLTEIKDGLTVTSRVEELVSVMQSNKD 34 >emb|CAB45055.1| hypothetical protein [Arabidopsis thaliana] gi|7269270|emb|CAB79330.1| hypothetical protein [Arabidopsis thaliana] Length = 1039 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +1 Query: 163 MMLEDFFTLTEMKDGLASVSRVEELISLMQKNKD 264 M LEDFFTLTE+KDGL SRVEEL+S+MQ NKD Sbjct: 1 MTLEDFFTLTEIKDGLTVTSRVEELVSVMQSNKD 34