BLASTX nr result
ID: Akebia22_contig00026441
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00026441 (480 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003843508.1| hypothetical protein LEMA_P076180.1 [Leptosp... 57 2e-06 ref|XP_003303028.1| hypothetical protein PTT_15051 [Pyrenophora ... 56 5e-06 gb|EOA82733.1| hypothetical protein SETTUDRAFT_96057 [Setosphaer... 55 8e-06 >ref|XP_003843508.1| hypothetical protein LEMA_P076180.1 [Leptosphaeria maculans JN3] gi|312220087|emb|CBY00029.1| hypothetical protein LEMA_P076180.1 [Leptosphaeria maculans JN3] Length = 282 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +3 Query: 3 EMEIGGKLFFDLFVAMCNNMDDMGDQLSTRGTPR 104 EME+GGKLFFDLFVAMCN++DD+ D + RGTPR Sbjct: 247 EMEMGGKLFFDLFVAMCNHVDDLVDVSNARGTPR 280 >ref|XP_003303028.1| hypothetical protein PTT_15051 [Pyrenophora teres f. teres 0-1] gi|311321250|gb|EFQ88863.1| hypothetical protein PTT_15051 [Pyrenophora teres f. teres 0-1] Length = 285 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/35 (74%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = +3 Query: 3 EMEIGGKLFFDLFVAMCNNMDDMGD-QLSTRGTPR 104 EME+GGKLFFDLFVAMCN++DD+ D S RGTPR Sbjct: 249 EMEMGGKLFFDLFVAMCNHVDDLADASASARGTPR 283 >gb|EOA82733.1| hypothetical protein SETTUDRAFT_96057 [Setosphaeria turcica Et28A] Length = 285 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/35 (71%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = +3 Query: 3 EMEIGGKLFFDLFVAMCNNMDDMGD-QLSTRGTPR 104 EME+GGK+FFDLFVAMCN++DD+ D S RGTPR Sbjct: 249 EMEMGGKMFFDLFVAMCNHVDDLADASASARGTPR 283