BLASTX nr result
ID: Akebia22_contig00026096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00026096 (209 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlise... 123 2e-26 ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 73 4e-11 >gb|EPS74345.1| hypothetical protein M569_00407, partial [Genlisea aurea] Length = 84 Score = 123 bits (309), Expect = 2e-26 Identities = 58/62 (93%), Positives = 58/62 (93%) Frame = -3 Query: 207 PSTRGLGWANLWCTGCYANSSAGQLSWYGRTAAPREILLYTSSRTRFLNRT*IGERCKHR 28 PSTRGLGWANLW TGCYANSSAG LSWYGRTAA REILLYTSSRTRFLNRT IGERCKHR Sbjct: 23 PSTRGLGWANLWSTGCYANSSAGLLSWYGRTAAQREILLYTSSRTRFLNRTSIGERCKHR 82 Query: 27 EV 22 EV Sbjct: 83 EV 84 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +3 Query: 3 LVRDRFTPRGAYTSRLSKFCSKTSYENLYREGFP 104 LVRDRFTPRGAYTSRLSKFCSKTS+ENLYREGFP Sbjct: 361 LVRDRFTPRGAYTSRLSKFCSKTSFENLYREGFP 394