BLASTX nr result
ID: Akebia22_contig00025535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00025535 (221 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007016621.1| Phototropin 1 isoform 7 [Theobroma cacao] gi... 61 2e-07 ref|XP_007016620.1| Phototropin 1 isoform 6 [Theobroma cacao] gi... 61 2e-07 ref|XP_007016618.1| Phototropin 1 isoform 4 [Theobroma cacao] gi... 61 2e-07 ref|XP_007016617.1| Phototropin 1 isoform 3, partial [Theobroma ... 61 2e-07 ref|XP_007016615.1| Phototropin 1 isoform 1 [Theobroma cacao] gi... 61 2e-07 ref|XP_006828236.1| hypothetical protein AMTR_s00023p00186390 [A... 60 3e-07 ref|XP_006365149.1| PREDICTED: LOW QUALITY PROTEIN: phototropin-... 60 4e-07 ref|XP_002531832.1| serine/threonine protein kinase, putative [R... 60 4e-07 ref|NP_001234214.1| phototropin-1 [Solanum lycopersicum] gi|1511... 60 4e-07 emb|CBI16229.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_002281752.1| PREDICTED: phototropin-1-like [Vitis vinifera] 59 5e-07 ref|XP_002298559.1| kinase family protein [Populus trichocarpa] ... 57 2e-06 gb|EXC33203.1| hypothetical protein L484_011180 [Morus notabilis] 57 3e-06 ref|XP_006488214.1| PREDICTED: phototropin-1-like [Citrus sinensis] 56 6e-06 ref|XP_006424699.1| hypothetical protein CICLE_v10027740mg [Citr... 56 6e-06 ref|XP_007208378.1| hypothetical protein PRUPE_ppa000777mg [Prun... 55 1e-05 >ref|XP_007016621.1| Phototropin 1 isoform 7 [Theobroma cacao] gi|508786984|gb|EOY34240.1| Phototropin 1 isoform 7 [Theobroma cacao] Length = 903 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 131 KVSLHGRQLMYRLLHRDPKNRLGSREGANETK 36 +VSLHG+QLMYRLLH+DPKNRLGSREGA+E K Sbjct: 828 QVSLHGKQLMYRLLHKDPKNRLGSREGASEIK 859 >ref|XP_007016620.1| Phototropin 1 isoform 6 [Theobroma cacao] gi|508786983|gb|EOY34239.1| Phototropin 1 isoform 6 [Theobroma cacao] Length = 908 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 131 KVSLHGRQLMYRLLHRDPKNRLGSREGANETK 36 +VSLHG+QLMYRLLH+DPKNRLGSREGA+E K Sbjct: 828 QVSLHGKQLMYRLLHKDPKNRLGSREGASEIK 859 >ref|XP_007016618.1| Phototropin 1 isoform 4 [Theobroma cacao] gi|508786981|gb|EOY34237.1| Phototropin 1 isoform 4 [Theobroma cacao] Length = 996 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 131 KVSLHGRQLMYRLLHRDPKNRLGSREGANETK 36 +VSLHG+QLMYRLLH+DPKNRLGSREGA+E K Sbjct: 921 QVSLHGKQLMYRLLHKDPKNRLGSREGASEIK 952 >ref|XP_007016617.1| Phototropin 1 isoform 3, partial [Theobroma cacao] gi|508786980|gb|EOY34236.1| Phototropin 1 isoform 3, partial [Theobroma cacao] Length = 977 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 131 KVSLHGRQLMYRLLHRDPKNRLGSREGANETK 36 +VSLHG+QLMYRLLH+DPKNRLGSREGA+E K Sbjct: 921 QVSLHGKQLMYRLLHKDPKNRLGSREGASEIK 952 >ref|XP_007016615.1| Phototropin 1 isoform 1 [Theobroma cacao] gi|590590035|ref|XP_007016619.1| Phototropin 1 isoform 1 [Theobroma cacao] gi|508786978|gb|EOY34234.1| Phototropin 1 isoform 1 [Theobroma cacao] gi|508786982|gb|EOY34238.1| Phototropin 1 isoform 1 [Theobroma cacao] Length = 1001 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 131 KVSLHGRQLMYRLLHRDPKNRLGSREGANETK 36 +VSLHG+QLMYRLLH+DPKNRLGSREGA+E K Sbjct: 921 QVSLHGKQLMYRLLHKDPKNRLGSREGASEIK 952 >ref|XP_006828236.1| hypothetical protein AMTR_s00023p00186390 [Amborella trichopoda] gi|548832883|gb|ERM95652.1| hypothetical protein AMTR_s00023p00186390 [Amborella trichopoda] Length = 1061 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 128 VSLHGRQLMYRLLHRDPKNRLGSREGANETK 36 VSLH RQLMYRLLHRDPKNRLGS EGANE K Sbjct: 957 VSLHARQLMYRLLHRDPKNRLGSSEGANELK 987 >ref|XP_006365149.1| PREDICTED: LOW QUALITY PROTEIN: phototropin-1-like [Solanum tuberosum] Length = 1022 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 125 SLHGRQLMYRLLHRDPKNRLGSREGANETK 36 SLH +QLMYRLLHRDPKNRLGSREGANE K Sbjct: 943 SLHAKQLMYRLLHRDPKNRLGSREGANEIK 972 >ref|XP_002531832.1| serine/threonine protein kinase, putative [Ricinus communis] gi|223528528|gb|EEF30552.1| serine/threonine protein kinase, putative [Ricinus communis] Length = 1006 Score = 59.7 bits (143), Expect = 4e-07 Identities = 35/77 (45%), Positives = 39/77 (50%), Gaps = 35/77 (45%) Frame = -1 Query: 131 KVSLHGRQLMYRLLHRDPKNRLGSREGANE------------------------------ 42 +VSLH +QLMYRLLHRDPKNRLGS EGANE Sbjct: 926 QVSLHAKQLMYRLLHRDPKNRLGSHEGANEIKRHPFFKGVNWALVRCMNPPELDTPIFEN 985 Query: 41 -----TKVVDPELLDLQ 6 K++DPELLDLQ Sbjct: 986 EAEKEAKLIDPELLDLQ 1002 >ref|NP_001234214.1| phototropin-1 [Solanum lycopersicum] gi|151176133|gb|ABN42185.2| phototropin-1 [Solanum lycopersicum] Length = 1018 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 125 SLHGRQLMYRLLHRDPKNRLGSREGANETK 36 SLH +QLMYRLLHRDPKNRLGSREGANE K Sbjct: 939 SLHAKQLMYRLLHRDPKNRLGSREGANEIK 968 >emb|CBI16229.3| unnamed protein product [Vitis vinifera] Length = 958 Score = 59.3 bits (142), Expect = 5e-07 Identities = 37/78 (47%), Positives = 39/78 (50%), Gaps = 36/78 (46%) Frame = -1 Query: 128 VSLHGRQLMYRLLHRDPKNRLGSREGAN-------------------------------- 45 VSL+ +QLMYRLLHRDPKNRLGSREGAN Sbjct: 878 VSLNAKQLMYRLLHRDPKNRLGSREGANEIKRHPFFRGVNWALVRCMNPPELDAPPLETT 937 Query: 44 ----ETKVVDPELLDLQT 3 E K VDPELLDLQT Sbjct: 938 DAEKEVKSVDPELLDLQT 955 >ref|XP_002281752.1| PREDICTED: phototropin-1-like [Vitis vinifera] Length = 1004 Score = 59.3 bits (142), Expect = 5e-07 Identities = 37/78 (47%), Positives = 39/78 (50%), Gaps = 36/78 (46%) Frame = -1 Query: 128 VSLHGRQLMYRLLHRDPKNRLGSREGAN-------------------------------- 45 VSL+ +QLMYRLLHRDPKNRLGSREGAN Sbjct: 924 VSLNAKQLMYRLLHRDPKNRLGSREGANEIKRHPFFRGVNWALVRCMNPPELDAPPLETT 983 Query: 44 ----ETKVVDPELLDLQT 3 E K VDPELLDLQT Sbjct: 984 DAEKEVKSVDPELLDLQT 1001 >ref|XP_002298559.1| kinase family protein [Populus trichocarpa] gi|222845817|gb|EEE83364.1| kinase family protein [Populus trichocarpa] Length = 977 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 128 VSLHGRQLMYRLLHRDPKNRLGSREGANETK 36 VSL+ +QLMYRLLHRDPKNRLGSREGAN+ K Sbjct: 898 VSLNAKQLMYRLLHRDPKNRLGSREGANDIK 928 >gb|EXC33203.1| hypothetical protein L484_011180 [Morus notabilis] Length = 962 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -1 Query: 125 SLHGRQLMYRLLHRDPKNRLGSREGANETK 36 SL +QLMYRLLHRDPKNRLGSREGANE K Sbjct: 883 SLQAKQLMYRLLHRDPKNRLGSREGANELK 912 >ref|XP_006488214.1| PREDICTED: phototropin-1-like [Citrus sinensis] Length = 1002 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 125 SLHGRQLMYRLLHRDPKNRLGSREGANETK 36 SLH +QLMYRLLHRDPK+RLGS EGANE K Sbjct: 924 SLHAKQLMYRLLHRDPKSRLGSHEGANEIK 953 >ref|XP_006424699.1| hypothetical protein CICLE_v10027740mg [Citrus clementina] gi|557526633|gb|ESR37939.1| hypothetical protein CICLE_v10027740mg [Citrus clementina] Length = 1002 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 125 SLHGRQLMYRLLHRDPKNRLGSREGANETK 36 SLH +QLMYRLLHRDPK+RLGS EGANE K Sbjct: 924 SLHAKQLMYRLLHRDPKSRLGSHEGANEIK 953 >ref|XP_007208378.1| hypothetical protein PRUPE_ppa000777mg [Prunus persica] gi|462404020|gb|EMJ09577.1| hypothetical protein PRUPE_ppa000777mg [Prunus persica] Length = 1007 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 125 SLHGRQLMYRLLHRDPKNRLGSREGANETK 36 SL +QLMYRLLHRDPKNRLGS+EGANE K Sbjct: 928 SLQAKQLMYRLLHRDPKNRLGSQEGANEIK 957