BLASTX nr result
ID: Akebia22_contig00022513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00022513 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERF74049.1| hypothetical protein EPUS_03864 [Endocarpon pusil... 56 5e-06 >gb|ERF74049.1| hypothetical protein EPUS_03864 [Endocarpon pusillum Z07020] Length = 78 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -1 Query: 305 DFESDAMAAMSSYSRQMHQHTRAQMDTSCRSLRRKSATSSAVDPHASLPQG 153 D+ESDA+AAM+ YSR MH HT QM+ + R+ RR+ A S AV +A L +G Sbjct: 16 DYESDAVAAMTEYSRIMHSHTMKQMENARRASRRRDAESGAVSANAKLRKG 66