BLASTX nr result
ID: Akebia22_contig00022191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00022191 (520 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007226779.1| hypothetical protein PRUPE_ppa018015mg [Prun... 130 2e-28 ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily pr... 129 4e-28 gb|EXB44248.1| hypothetical protein L484_001646 [Morus notabilis] 128 9e-28 emb|CBI24015.3| unnamed protein product [Vitis vinifera] 128 9e-28 ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containi... 128 9e-28 ref|XP_004965051.1| PREDICTED: pentatricopeptide repeat-containi... 126 4e-27 ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containi... 124 1e-26 ref|XP_007154464.1| hypothetical protein PHAVU_003G121400g [Phas... 123 2e-26 gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] 123 2e-26 gb|EYU20789.1| hypothetical protein MIMGU_mgv1a002968mg [Mimulus... 122 4e-26 ref|XP_003564043.1| PREDICTED: pentatricopeptide repeat-containi... 122 4e-26 ref|XP_003541335.1| PREDICTED: pentatricopeptide repeat-containi... 122 7e-26 ref|NP_001147320.1| selenium-binding protein-like [Zea mays] gi|... 121 9e-26 gb|ACF82562.1| unknown [Zea mays] gi|413957085|gb|AFW89734.1| se... 121 9e-26 ref|XP_006655943.1| PREDICTED: pentatricopeptide repeat-containi... 120 1e-25 ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [S... 120 3e-25 ref|XP_004253185.1| PREDICTED: pentatricopeptide repeat-containi... 119 4e-25 ref|XP_002873264.1| pentatricopeptide repeat-containing protein ... 119 4e-25 ref|XP_006289319.1| hypothetical protein CARUB_v10002804mg [Caps... 119 6e-25 gb|AFW58607.1| hypothetical protein ZEAMMB73_481408 [Zea mays] 119 6e-25 >ref|XP_007226779.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica] gi|462423715|gb|EMJ27978.1| hypothetical protein PRUPE_ppa018015mg [Prunus persica] Length = 624 Score = 130 bits (326), Expect = 2e-28 Identities = 58/68 (85%), Positives = 65/68 (95%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGLLKT+ G T+RI+KNLRVC+DCH+ASKLISKVFDREIIVRDRNRFHHF+ G Sbjct: 557 SEKLAIAFGLLKTKPGETLRISKNLRVCKDCHQASKLISKVFDREIIVRDRNRFHHFKRG 616 Query: 338 ECSCKDYW 315 +CSCKDYW Sbjct: 617 DCSCKDYW 624 >ref|XP_007035985.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508715014|gb|EOY06911.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 628 Score = 129 bits (324), Expect = 4e-28 Identities = 59/68 (86%), Positives = 63/68 (92%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIA GLLKT++G T RI KNLRVCRDCH ASKLISKVFDREIIVRDRNRFHHF++G Sbjct: 561 SEKLAIALGLLKTKTGETFRITKNLRVCRDCHHASKLISKVFDREIIVRDRNRFHHFKDG 620 Query: 338 ECSCKDYW 315 ECSCKDYW Sbjct: 621 ECSCKDYW 628 >gb|EXB44248.1| hypothetical protein L484_001646 [Morus notabilis] Length = 633 Score = 128 bits (321), Expect = 9e-28 Identities = 58/68 (85%), Positives = 64/68 (94%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGLLKT+ G TIRI+KNLRVC+DCH ASKL+SKVF+REIIVRDRNRFHHFR G Sbjct: 566 SEKLAIAFGLLKTKPGETIRISKNLRVCKDCHNASKLVSKVFEREIIVRDRNRFHHFRMG 625 Query: 338 ECSCKDYW 315 ECSC+DYW Sbjct: 626 ECSCQDYW 633 >emb|CBI24015.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 128 bits (321), Expect = 9e-28 Identities = 57/68 (83%), Positives = 64/68 (94%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGLLKT+ G T+RI+KNLR+CRDCH+ASKLISKV+DREII+RDRNRFHHFR G Sbjct: 502 SEKLAIAFGLLKTKPGETLRISKNLRICRDCHQASKLISKVYDREIIIRDRNRFHHFRMG 561 Query: 338 ECSCKDYW 315 CSCKDYW Sbjct: 562 GCSCKDYW 569 >ref|XP_002263755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 624 Score = 128 bits (321), Expect = 9e-28 Identities = 57/68 (83%), Positives = 64/68 (94%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGLLKT+ G T+RI+KNLR+CRDCH+ASKLISKV+DREII+RDRNRFHHFR G Sbjct: 557 SEKLAIAFGLLKTKPGETLRISKNLRICRDCHQASKLISKVYDREIIIRDRNRFHHFRMG 616 Query: 338 ECSCKDYW 315 CSCKDYW Sbjct: 617 GCSCKDYW 624 >ref|XP_004965051.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Setaria italica] Length = 601 Score = 126 bits (316), Expect = 4e-27 Identities = 55/68 (80%), Positives = 63/68 (92%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGLL+T G T+RI KNLRVCRDCHEA+K +S+VFDREI+VRDRNRFHHFR+G Sbjct: 534 SEKLAIAFGLLRTRPGDTMRITKNLRVCRDCHEATKFVSRVFDREIVVRDRNRFHHFRDG 593 Query: 338 ECSCKDYW 315 +CSCKDYW Sbjct: 594 KCSCKDYW 601 >ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum tuberosum] Length = 628 Score = 124 bits (311), Expect = 1e-26 Identities = 55/68 (80%), Positives = 62/68 (91%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGLLK++ G +RI KNLRVC+DCH+ASK ISKV+DREIIVRDRNRFHHF+ G Sbjct: 561 SEKLAIAFGLLKSKPGEILRITKNLRVCKDCHQASKFISKVYDREIIVRDRNRFHHFKGG 620 Query: 338 ECSCKDYW 315 ECSCKDYW Sbjct: 621 ECSCKDYW 628 >ref|XP_007154464.1| hypothetical protein PHAVU_003G121400g [Phaseolus vulgaris] gi|561027818|gb|ESW26458.1| hypothetical protein PHAVU_003G121400g [Phaseolus vulgaris] Length = 604 Score = 123 bits (309), Expect = 2e-26 Identities = 53/68 (77%), Positives = 63/68 (92%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIA+GLLKT+ G T+R+ KNLRVC+DCH+ASKLIS+V+D +II+RDRNRFHHF NG Sbjct: 537 SEKLAIAYGLLKTKRGETLRVTKNLRVCKDCHQASKLISRVYDCDIIIRDRNRFHHFSNG 596 Query: 338 ECSCKDYW 315 ECSCKDYW Sbjct: 597 ECSCKDYW 604 >gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] Length = 542 Score = 123 bits (309), Expect = 2e-26 Identities = 54/68 (79%), Positives = 62/68 (91%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGLL+T G T+R+ KNLRVCRDCHEA+KLIS+VF+REI+VRDRNRFHHFR+G Sbjct: 366 SEKLAIAFGLLRTRPGDTMRVTKNLRVCRDCHEATKLISRVFEREIVVRDRNRFHHFRDG 425 Query: 338 ECSCKDYW 315 CSC DYW Sbjct: 426 ACSCNDYW 433 >gb|EYU20789.1| hypothetical protein MIMGU_mgv1a002968mg [Mimulus guttatus] Length = 621 Score = 122 bits (307), Expect = 4e-26 Identities = 55/68 (80%), Positives = 61/68 (89%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIA+GLLKT++G TIR+ KNLRVCRDCH ASKLIS V+DREI+VRDRNRFHHFR G Sbjct: 554 SEKLAIAYGLLKTKAGETIRVTKNLRVCRDCHVASKLISMVYDREIVVRDRNRFHHFRGG 613 Query: 338 ECSCKDYW 315 CSC DYW Sbjct: 614 LCSCNDYW 621 >ref|XP_003564043.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Brachypodium distachyon] Length = 599 Score = 122 bits (307), Expect = 4e-26 Identities = 53/68 (77%), Positives = 62/68 (91%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGLL+T G T+RI KNLRVCRDCHEA+K IS+VF+REI+VRDRNRFHHF++G Sbjct: 532 SEKLAIAFGLLRTRPGDTVRITKNLRVCRDCHEATKFISRVFEREIVVRDRNRFHHFKDG 591 Query: 338 ECSCKDYW 315 CSC+DYW Sbjct: 592 TCSCRDYW 599 >ref|XP_003541335.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] Length = 607 Score = 122 bits (305), Expect = 7e-26 Identities = 52/68 (76%), Positives = 63/68 (92%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIA+GLLKT+ G T+R+ KNLRVC+DCH+ASK+ISKV+D +II+RDR+RFHHF NG Sbjct: 540 SEKLAIAYGLLKTKRGETLRVTKNLRVCKDCHQASKMISKVYDCDIIIRDRSRFHHFSNG 599 Query: 338 ECSCKDYW 315 ECSCKDYW Sbjct: 600 ECSCKDYW 607 >ref|NP_001147320.1| selenium-binding protein-like [Zea mays] gi|195609890|gb|ACG26775.1| selenium-binding protein-like [Zea mays] Length = 605 Score = 121 bits (304), Expect = 9e-26 Identities = 52/68 (76%), Positives = 62/68 (91%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGLL T G T+RI KNLRVCRDCHEA+K +S+VF+R+I+VRDRNRFHHF++G Sbjct: 538 SEKLAIAFGLLHTRPGDTMRITKNLRVCRDCHEATKFVSRVFERQIVVRDRNRFHHFKDG 597 Query: 338 ECSCKDYW 315 +CSCKDYW Sbjct: 598 QCSCKDYW 605 >gb|ACF82562.1| unknown [Zea mays] gi|413957085|gb|AFW89734.1| selenium-binding protein-like protein [Zea mays] Length = 605 Score = 121 bits (304), Expect = 9e-26 Identities = 52/68 (76%), Positives = 62/68 (91%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGLL T G T+RI KNLRVCRDCHEA+K +S+VF+R+I+VRDRNRFHHF++G Sbjct: 538 SEKLAIAFGLLHTRPGDTMRITKNLRVCRDCHEATKFVSRVFERQIVVRDRNRFHHFKDG 597 Query: 338 ECSCKDYW 315 +CSCKDYW Sbjct: 598 QCSCKDYW 605 >ref|XP_006655943.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Oryza brachyantha] Length = 598 Score = 120 bits (302), Expect = 1e-25 Identities = 52/68 (76%), Positives = 61/68 (89%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGLL+ T+RI KNLRVCRDCHEA+K++S+VFDREI+VRDRNRFHHF++G Sbjct: 531 SEKLAIAFGLLRARPRETLRITKNLRVCRDCHEATKIVSRVFDREIVVRDRNRFHHFKDG 590 Query: 338 ECSCKDYW 315 CSCKDYW Sbjct: 591 TCSCKDYW 598 >ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] gi|241939236|gb|EES12381.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] Length = 693 Score = 120 bits (300), Expect = 3e-25 Identities = 52/68 (76%), Positives = 62/68 (91%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGL+K + GATIR++KNLRVC DCH A+KLISKV++REI+VRDRNRFHHF++G Sbjct: 626 SEKLAIAFGLMKLDPGATIRLSKNLRVCTDCHSATKLISKVYNREIVVRDRNRFHHFKDG 685 Query: 338 ECSCKDYW 315 CSC DYW Sbjct: 686 TCSCNDYW 693 >ref|XP_004253185.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum lycopersicum] Length = 626 Score = 119 bits (298), Expect = 4e-25 Identities = 53/68 (77%), Positives = 61/68 (89%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGLLK++ G +RI KNLRVC+DCH+ASK ISKV++ EIIVRDRNRFHHF+ G Sbjct: 559 SEKLAIAFGLLKSKPGDILRITKNLRVCKDCHQASKFISKVYNLEIIVRDRNRFHHFKGG 618 Query: 338 ECSCKDYW 315 ECSCKDYW Sbjct: 619 ECSCKDYW 626 >ref|XP_002873264.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319101|gb|EFH49523.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 624 Score = 119 bits (298), Expect = 4e-25 Identities = 52/68 (76%), Positives = 61/68 (89%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIA+G++KT++G TIRI KNLRVC DCH A+KLIS+V+ RE IVRDRNRFHHFRNG Sbjct: 557 SEKLAIAYGMMKTKTGTTIRIVKNLRVCEDCHTATKLISEVYGREFIVRDRNRFHHFRNG 616 Query: 338 ECSCKDYW 315 CSC+DYW Sbjct: 617 LCSCRDYW 624 >ref|XP_006289319.1| hypothetical protein CARUB_v10002804mg [Capsella rubella] gi|482558025|gb|EOA22217.1| hypothetical protein CARUB_v10002804mg [Capsella rubella] Length = 622 Score = 119 bits (297), Expect = 6e-25 Identities = 51/68 (75%), Positives = 60/68 (88%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIA+G++KT++G TIRI KNLRVC DCH +KLIS+V+ RE IVRDRNRFHHFRNG Sbjct: 555 SEKLAIAYGMMKTKAGTTIRIVKNLRVCEDCHTVTKLISEVYGREFIVRDRNRFHHFRNG 614 Query: 338 ECSCKDYW 315 CSC+DYW Sbjct: 615 SCSCRDYW 622 >gb|AFW58607.1| hypothetical protein ZEAMMB73_481408 [Zea mays] Length = 694 Score = 119 bits (297), Expect = 6e-25 Identities = 52/68 (76%), Positives = 61/68 (89%) Frame = -3 Query: 518 SEKLAIAFGLLKTESGATIRIAKNLRVCRDCHEASKLISKVFDREIIVRDRNRFHHFRNG 339 SEKLAIAFGL+K + GATIR++KNLRVC DCH A+KLISKV+DREI+VRDRN FHHF++G Sbjct: 627 SEKLAIAFGLMKLDPGATIRLSKNLRVCADCHSATKLISKVYDREIVVRDRNIFHHFKDG 686 Query: 338 ECSCKDYW 315 CSC DYW Sbjct: 687 TCSCNDYW 694