BLASTX nr result
ID: Akebia22_contig00021999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00021999 (302 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON67949.1| hypothetical protein W97_07446 [Coniosporium apol... 105 7e-21 gb|EKG15940.1| Conidiation-specific protein 6 [Macrophomina phas... 88 1e-15 ref|XP_003008824.1| conserved hypothetical protein [Verticillium... 77 3e-12 gb|EGY13432.1| hypothetical protein VDAG_00114 [Verticillium dah... 76 4e-12 ref|XP_001940739.1| conidiation-specific protein 6 [Pyrenophora ... 75 7e-12 ref|XP_003299433.1| hypothetical protein PTT_10417 [Pyrenophora ... 75 1e-11 ref|XP_002839905.1| hypothetical protein [Tuber melanosporum Mel... 75 1e-11 gb|EMC92159.1| hypothetical protein BAUCODRAFT_38184 [Baudoinia ... 74 2e-11 gb|EOA85438.1| hypothetical protein SETTUDRAFT_90143 [Setosphaer... 73 5e-11 gb|EXA44629.1| hypothetical protein FOVG_06007 [Fusarium oxyspor... 71 1e-10 ref|XP_003302011.1| hypothetical protein PTT_13682 [Pyrenophora ... 70 2e-10 gb|EWZ37057.1| hypothetical protein FOZG_10925 [Fusarium oxyspor... 70 3e-10 ref|XP_007584165.1| putative conidiation-specific protein 6 prot... 70 3e-10 gb|EUC27878.1| hypothetical protein COCCADRAFT_9644 [Bipolaris z... 70 4e-10 emb|CCT68431.1| probable conidiation protein 6 (con-6) [Fusarium... 70 4e-10 gb|EMT63370.1| Conidiation-specific protein 6 [Fusarium oxysporu... 70 4e-10 gb|ENH81732.1| conidiation-specific protein 6 [Colletotrichum or... 69 5e-10 gb|EOA85035.1| hypothetical protein SETTUDRAFT_89997 [Setosphaer... 69 7e-10 gb|EMD94560.1| hypothetical protein COCHEDRAFT_1167532 [Bipolari... 69 7e-10 ref|XP_007378422.1| hypothetical protein PUNSTDRAFT_129184 [Punc... 69 7e-10 >gb|EON67949.1| hypothetical protein W97_07446 [Coniosporium apollinis CBS 100218] Length = 96 Score = 105 bits (262), Expect = 7e-21 Identities = 52/72 (72%), Positives = 59/72 (81%) Frame = -2 Query: 223 NMSPEDISNAASGHKANLSNPNTSEESKQHSREELKKLGGDDAFYSQDEPLGHEKNPGNV 44 N SPEDISN A GHKANLSNPNTSE SK++SR+ L+ LGG+DAFY + E EKNPGNV Sbjct: 12 NESPEDISNQAQGHKANLSNPNTSEASKENSRQALEDLGGEDAFYGKKE---EEKNPGNV 68 Query: 43 AGGLKATINQPE 8 AGGLKATIN P+ Sbjct: 69 AGGLKATINNPQ 80 >gb|EKG15940.1| Conidiation-specific protein 6 [Macrophomina phaseolina MS6] Length = 108 Score = 87.8 bits (216), Expect = 1e-15 Identities = 44/70 (62%), Positives = 54/70 (77%) Frame = -2 Query: 223 NMSPEDISNAASGHKANLSNPNTSEESKQHSREELKKLGGDDAFYSQDEPLGHEKNPGNV 44 N PEDIS+ A GHKANLSNPNTSEESK++SR+ L+ LGG+ AFY ++E K+P V Sbjct: 17 NDQPEDISHQAQGHKANLSNPNTSEESKKNSRQVLESLGGEGAFYGKEE---ESKDPTRV 73 Query: 43 AGGLKATINQ 14 A GLK+TINQ Sbjct: 74 AAGLKSTINQ 83 >ref|XP_003008824.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|261351970|gb|EEY14398.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] Length = 88 Score = 76.6 bits (187), Expect = 3e-12 Identities = 42/71 (59%), Positives = 49/71 (69%), Gaps = 3/71 (4%) Frame = -2 Query: 214 PEDISNAASGHKANLSNPNTSEESKQHSREEL-KKLGGDDA--FYSQDEPLGHEKNPGNV 44 P D + A GHKAN++NPNTSEESKQHSR+ L + GG+DA S KNPGNV Sbjct: 2 PSD-AQVAGGHKANINNPNTSEESKQHSRDVLNNEFGGEDAPNAASAQSANDDNKNPGNV 60 Query: 43 AGGLKATINQP 11 AGGLKAT+N P Sbjct: 61 AGGLKATLNNP 71 >gb|EGY13432.1| hypothetical protein VDAG_00114 [Verticillium dahliae VdLs.17] Length = 88 Score = 76.3 bits (186), Expect = 4e-12 Identities = 42/71 (59%), Positives = 48/71 (67%), Gaps = 3/71 (4%) Frame = -2 Query: 214 PEDISNAASGHKANLSNPNTSEESKQHSREELKK-LGGDDA--FYSQDEPLGHEKNPGNV 44 P D + A GHKAN++NPNTSEESKQHSR+ L GG+DA S KNPGNV Sbjct: 2 PSD-AQVAGGHKANINNPNTSEESKQHSRDVLNNDFGGEDAPNAASAQSANDDNKNPGNV 60 Query: 43 AGGLKATINQP 11 AGGLKAT+N P Sbjct: 61 AGGLKATLNNP 71 >ref|XP_001940739.1| conidiation-specific protein 6 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187976832|gb|EDU43458.1| conidiation-specific protein 6 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 87 Score = 75.5 bits (184), Expect = 7e-12 Identities = 37/64 (57%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = -2 Query: 199 NAASGHKANLSNPNTSEESKQHSREELKKL-GGDDAFYSQDEPLGHEKNPGNVAGGLKAT 23 N GHKANL+NPNTS+E+KQHS+E L + G + S G EKNP NVAGGLKAT Sbjct: 6 NVIGGHKANLNNPNTSDEAKQHSKEVLSSIDNGGEVPTSNSSSSGGEKNPNNVAGGLKAT 65 Query: 22 INQP 11 +N P Sbjct: 66 LNNP 69 >ref|XP_003299433.1| hypothetical protein PTT_10417 [Pyrenophora teres f. teres 0-1] gi|311326901|gb|EFQ92470.1| hypothetical protein PTT_10417 [Pyrenophora teres f. teres 0-1] Length = 87 Score = 75.1 bits (183), Expect = 1e-11 Identities = 37/64 (57%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = -2 Query: 199 NAASGHKANLSNPNTSEESKQHSREELKKL-GGDDAFYSQDEPLGHEKNPGNVAGGLKAT 23 N GHKANL+NPNTS+E+KQHS+E L + G D S G +KNP NVAGGLKAT Sbjct: 6 NVIGGHKANLNNPNTSDEAKQHSKEVLSSIDNGGDIPTSNSSSNGGDKNPNNVAGGLKAT 65 Query: 22 INQP 11 +N P Sbjct: 66 LNNP 69 >ref|XP_002839905.1| hypothetical protein [Tuber melanosporum Mel28] gi|295636112|emb|CAZ84096.1| unnamed protein product [Tuber melanosporum] Length = 98 Score = 75.1 bits (183), Expect = 1e-11 Identities = 40/79 (50%), Positives = 51/79 (64%), Gaps = 5/79 (6%) Frame = -2 Query: 232 MSSNMSPEDISNAASGHKANLSNPNTSEESKQHSREELKKLGGDDAFYSQDEPLGHE--- 62 M S +++ N GHKANL NPNTS E+KQHSRE L++LG + Y+ P G + Sbjct: 1 MDSASDQKNLGNVIGGHKANLHNPNTSPEAKQHSREVLEELGFETTSYTSG-PSGVDVNI 59 Query: 61 --KNPGNVAGGLKATINQP 11 KNPGNVAGG KAT++ P Sbjct: 60 EGKNPGNVAGGYKATLHNP 78 >gb|EMC92159.1| hypothetical protein BAUCODRAFT_38184 [Baudoinia compniacensis UAMH 10762] Length = 93 Score = 73.9 bits (180), Expect = 2e-11 Identities = 38/68 (55%), Positives = 49/68 (72%), Gaps = 3/68 (4%) Frame = -2 Query: 211 EDISNAASGHKANLSNPNTSEESKQHSREELKKLGGDDAFYSQ---DEPLGHEKNPGNVA 41 ED +AA GHKANLSNPNTSEESK++SR+ L++LGG+DAFY + D P + V Sbjct: 6 EDRMHAAQGHKANLSNPNTSEESKKNSRQALEQLGGEDAFYGKKGDDAPAAGMGDDNRVL 65 Query: 40 GGLKATIN 17 GG KAT++ Sbjct: 66 GGHKATLS 73 >gb|EOA85438.1| hypothetical protein SETTUDRAFT_90143 [Setosphaeria turcica Et28A] Length = 85 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/65 (56%), Positives = 47/65 (72%), Gaps = 2/65 (3%) Frame = -2 Query: 199 NAASGHKANLSNPNTSEESKQHSREELKKL--GGDDAFYSQDEPLGHEKNPGNVAGGLKA 26 N GHKANLSNPNTS+E+KQHS+E L+++ GGD + + +KNP NVAGGLKA Sbjct: 7 NIIGGHKANLSNPNTSDEAKQHSKEVLQEIENGGDPQSMTSN---SGDKNPNNVAGGLKA 63 Query: 25 TINQP 11 T+N P Sbjct: 64 TLNNP 68 >gb|EXA44629.1| hypothetical protein FOVG_06007 [Fusarium oxysporum f. sp. pisi HDV247] gi|590063055|gb|EXK90579.1| hypothetical protein FOQG_06812 [Fusarium oxysporum f. sp. raphani 54005] gi|591503688|gb|EXM33033.1| hypothetical protein FOTG_03154 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 84 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/65 (53%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = -2 Query: 202 SNAASGHKANLSNPNTSEESKQHSREELK-KLGGDDAFYSQDEPLGHEKNPGNVAGGLKA 26 + AA GHKA ++NPNTSEE+K+HSR+ L+ + G + ++D +KNPGNVAGGLKA Sbjct: 4 AQAAGGHKATINNPNTSEEAKEHSRQVLENEFNGGEVTGAED---NKDKNPGNVAGGLKA 60 Query: 25 TINQP 11 T+N P Sbjct: 61 TLNNP 65 >ref|XP_003302011.1| hypothetical protein PTT_13682 [Pyrenophora teres f. teres 0-1] gi|311322844|gb|EFQ89877.1| hypothetical protein PTT_13682 [Pyrenophora teres f. teres 0-1] Length = 75 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/47 (72%), Positives = 38/47 (80%) Frame = -2 Query: 223 NMSPEDISNAASGHKANLSNPNTSEESKQHSREELKKLGGDDAFYSQ 83 N + EDISN A GHKANLSNPNTSEESK+ S E LK LGG+DAFY + Sbjct: 24 NNTVEDISNQARGHKANLSNPNTSEESKKKSAEALKALGGEDAFYGK 70 >gb|EWZ37057.1| hypothetical protein FOZG_10925 [Fusarium oxysporum Fo47] Length = 84 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 202 SNAASGHKANLSNPNTSEESKQHSREELK-KLGGDDAFYSQDEPLGHEKNPGNVAGGLKA 26 + A GHKA ++NPNTSEE+K+HSR+ L+ + G + ++D +KNPGNVAGGLKA Sbjct: 4 AQVAGGHKATINNPNTSEEAKEHSRQALENEFNGGEVTGAED---NKDKNPGNVAGGLKA 60 Query: 25 TINQP 11 T+N P Sbjct: 61 TLNNP 65 >ref|XP_007584165.1| putative conidiation-specific protein 6 protein [Neofusicoccum parvum UCRNP2] gi|485923122|gb|EOD48357.1| putative conidiation-specific protein 6 protein [Neofusicoccum parvum UCRNP2] Length = 81 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/64 (57%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = -2 Query: 199 NAASGHKANLSNPNTSEESKQHSREELKKLGGDDAFYSQDEPLGHE-KNPGNVAGGLKAT 23 N GHKANL+NPNTS+E+KQHS+E L D F + P + KNPGNVAGGLKAT Sbjct: 6 NIIGGHKANLNNPNTSDEAKQHSKEVL-----DQEFDGGNIPQADQNKNPGNVAGGLKAT 60 Query: 22 INQP 11 +N P Sbjct: 61 LNNP 64 >gb|EUC27878.1| hypothetical protein COCCADRAFT_9644 [Bipolaris zeicola 26-R-13] gi|576930827|gb|EUC44400.1| hypothetical protein COCMIDRAFT_98293 [Bipolaris oryzae ATCC 44560] gi|578484708|gb|EUN22224.1| hypothetical protein COCVIDRAFT_30731 [Bipolaris victoriae FI3] Length = 85 Score = 69.7 bits (169), Expect = 4e-10 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 2/65 (3%) Frame = -2 Query: 199 NAASGHKANLSNPNTSEESKQHSREELKKL--GGDDAFYSQDEPLGHEKNPGNVAGGLKA 26 N GHKAN++NPNTSEE+KQHS+E L+ L GG+ S + +KNP NVAGGLKA Sbjct: 7 NVIGGHKANINNPNTSEEAKQHSKEVLQDLENGGEITSKSTSD---QDKNPNNVAGGLKA 63 Query: 25 TINQP 11 T+ P Sbjct: 64 TLKNP 68 >emb|CCT68431.1| probable conidiation protein 6 (con-6) [Fusarium fujikuroi IMI 58289] Length = 84 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/65 (53%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 202 SNAASGHKANLSNPNTSEESKQHSREELK-KLGGDDAFYSQDEPLGHEKNPGNVAGGLKA 26 + A GHKA ++NPNTSEE+K++SR+ LK + G D +++ EKNPGNVAGGLKA Sbjct: 4 AQVAGGHKATINNPNTSEEAKENSRQVLKNEFNGGDVTGAEE---NKEKNPGNVAGGLKA 60 Query: 25 TINQP 11 T+N P Sbjct: 61 TLNNP 65 >gb|EMT63370.1| Conidiation-specific protein 6 [Fusarium oxysporum f. sp. cubense race 4] gi|591470635|gb|EXM01939.1| hypothetical protein FOIG_07367 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 84 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 1/65 (1%) Frame = -2 Query: 202 SNAASGHKANLSNPNTSEESKQHSREELK-KLGGDDAFYSQDEPLGHEKNPGNVAGGLKA 26 + A GHKA ++NPNTSEE+K+HSR+ L+ + G + ++D +KNPGNVAGGLKA Sbjct: 4 AQVAGGHKATINNPNTSEEAKEHSRQVLENEFNGGEVTGAED---NKDKNPGNVAGGLKA 60 Query: 25 TINQP 11 T+N P Sbjct: 61 TLNNP 65 >gb|ENH81732.1| conidiation-specific protein 6 [Colletotrichum orbiculare MAFF 240422] Length = 83 Score = 69.3 bits (168), Expect = 5e-10 Identities = 37/65 (56%), Positives = 45/65 (69%), Gaps = 1/65 (1%) Frame = -2 Query: 202 SNAASGHKANLSNPNTSEESKQHSREELK-KLGGDDAFYSQDEPLGHEKNPGNVAGGLKA 26 + A GHKAN++NPNTSEESKQ+S+ L+ + G D S D EKNPGNVAGGLKA Sbjct: 5 AQVAGGHKANINNPNTSEESKQNSKTVLENEFNGGDVPKSGD---NEEKNPGNVAGGLKA 61 Query: 25 TINQP 11 T+ P Sbjct: 62 TLKNP 66 >gb|EOA85035.1| hypothetical protein SETTUDRAFT_89997 [Setosphaeria turcica Et28A] Length = 73 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = -2 Query: 223 NMSPEDISNAASGHKANLSNPNTSEESKQHSREELKKLGGDDAFYSQ 83 N + EDIS+ A+GHKANLSNPNTSE+SK++S E LK LGG+DAFY + Sbjct: 22 NNTVEDISHQAAGHKANLSNPNTSEQSKKNSAEALKALGGEDAFYGK 68 >gb|EMD94560.1| hypothetical protein COCHEDRAFT_1167532 [Bipolaris maydis C5] gi|477582538|gb|ENH99645.1| hypothetical protein COCC4DRAFT_152717 [Bipolaris maydis ATCC 48331] Length = 85 Score = 68.9 bits (167), Expect = 7e-10 Identities = 35/65 (53%), Positives = 45/65 (69%), Gaps = 2/65 (3%) Frame = -2 Query: 199 NAASGHKANLSNPNTSEESKQHSREELKKL--GGDDAFYSQDEPLGHEKNPGNVAGGLKA 26 N GHKAN++NPNTS+E+KQHS+E L+ L GG+ S + +KNP NVAGGLKA Sbjct: 7 NVIGGHKANINNPNTSDEAKQHSKEVLENLENGGEITSKSTSD---EDKNPNNVAGGLKA 63 Query: 25 TINQP 11 T+ P Sbjct: 64 TLKNP 68 >ref|XP_007378422.1| hypothetical protein PUNSTDRAFT_129184 [Punctularia strigosozonata HHB-11173 SS5] gi|390604114|gb|EIN13505.1| hypothetical protein PUNSTDRAFT_129184 [Punctularia strigosozonata HHB-11173 SS5] Length = 76 Score = 68.9 bits (167), Expect = 7e-10 Identities = 36/61 (59%), Positives = 43/61 (70%) Frame = -2 Query: 199 NAASGHKANLSNPNTSEESKQHSREELKKLGGDDAFYSQDEPLGHEKNPGNVAGGLKATI 20 N A GHKAN++NPNTSEESK+HSR+ L ++ D+P H KNP NVAGG KATI Sbjct: 6 NVAGGHKANINNPNTSEESKEHSRQVLSEIEESGIL---DQP-KHGKNPNNVAGGHKATI 61 Query: 19 N 17 N Sbjct: 62 N 62