BLASTX nr result
ID: Akebia22_contig00021847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00021847 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280001.1| PREDICTED: brefeldin A-inhibited guanine nuc... 59 8e-17 emb|CBI37718.3| unnamed protein product [Vitis vinifera] 59 8e-17 gb|AFW66223.1| hypothetical protein ZEAMMB73_670841 [Zea mays] 58 1e-16 ref|XP_004951596.1| PREDICTED: brefeldin A-inhibited guanine nuc... 58 2e-16 ref|XP_002453467.1| hypothetical protein SORBIDRAFT_04g006380 [S... 57 3e-16 gb|EXB40442.1| Brefeldin A-inhibited guanine nucleotide-exchange... 59 4e-16 ref|XP_007043107.1| SEC7-like guanine nucleotide exchange family... 57 8e-16 ref|XP_006648411.1| PREDICTED: brefeldin A-inhibited guanine nuc... 56 8e-16 ref|XP_006384870.1| guanine nucleotide exchange family protein [... 57 1e-15 dbj|BAD15400.1| putative guanine nucleotide-exchange protein GEP... 55 1e-15 gb|EEC72663.1| hypothetical protein OsI_06212 [Oryza sativa Indi... 55 1e-15 gb|EEE56489.1| hypothetical protein OsJ_05728 [Oryza sativa Japo... 55 1e-15 ref|XP_003571170.1| PREDICTED: brefeldin A-inhibited guanine nuc... 54 2e-15 ref|XP_006364333.1| PREDICTED: brefeldin A-inhibited guanine nuc... 55 2e-15 ref|XP_004231109.1| PREDICTED: brefeldin A-inhibited guanine nuc... 55 2e-15 ref|XP_007142583.1| hypothetical protein PHAVU_008G293100g [Phas... 57 4e-15 ref|XP_003519698.1| PREDICTED: brefeldin A-inhibited guanine nuc... 57 4e-15 ref|XP_003544583.1| PREDICTED: brefeldin A-inhibited guanine nuc... 57 4e-15 ref|XP_004965857.1| PREDICTED: brefeldin A-inhibited guanine nuc... 55 4e-15 ref|XP_004491652.1| PREDICTED: brefeldin A-inhibited guanine nuc... 57 4e-15 >ref|XP_002280001.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 2-like [Vitis vinifera] Length = 1702 Score = 59.3 bits (142), Expect(2) = 8e-17 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 109 QDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFYP 5 QD+TFRLESVK LV IIKSMGAWMD QL IGDF P Sbjct: 459 QDLTFRLESVKCLVSIIKSMGAWMDQQLIIGDFSP 493 Score = 53.1 bits (126), Expect(2) = 8e-17 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + D+FVNYDCDV+APNIFERTVNGLL Sbjct: 416 IIDIFVNYDCDVNAPNIFERTVNGLL 441 >emb|CBI37718.3| unnamed protein product [Vitis vinifera] Length = 1611 Score = 59.3 bits (142), Expect(2) = 8e-17 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 109 QDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFYP 5 QD+TFRLESVK LV IIKSMGAWMD QL IGDF P Sbjct: 391 QDLTFRLESVKCLVSIIKSMGAWMDQQLIIGDFSP 425 Score = 53.1 bits (126), Expect(2) = 8e-17 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + D+FVNYDCDV+APNIFERTVNGLL Sbjct: 348 IIDIFVNYDCDVNAPNIFERTVNGLL 373 >gb|AFW66223.1| hypothetical protein ZEAMMB73_670841 [Zea mays] Length = 1693 Score = 57.8 bits (138), Expect(2) = 1e-16 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFYP 5 AQD TFR+ESVK L IIKSMG+WMD QLRIGDF P Sbjct: 460 AQDQTFRIESVKCLATIIKSMGSWMDQQLRIGDFSP 495 Score = 53.9 bits (128), Expect(2) = 1e-16 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 L D+FVNYDCDVDAPNIFER VNGLL Sbjct: 418 LIDIFVNYDCDVDAPNIFERVVNGLL 443 >ref|XP_004951596.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Setaria italica] Length = 1706 Score = 57.8 bits (138), Expect(2) = 2e-16 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFYP 5 AQD TFR+ESVK L IIKSMG+WMD QLRIGDF P Sbjct: 462 AQDQTFRIESVKCLATIIKSMGSWMDQQLRIGDFSP 497 Score = 53.1 bits (126), Expect(2) = 2e-16 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 L DVFVNYDCD+DAPNIFER VNGLL Sbjct: 420 LIDVFVNYDCDLDAPNIFERAVNGLL 445 >ref|XP_002453467.1| hypothetical protein SORBIDRAFT_04g006380 [Sorghum bicolor] gi|241933298|gb|EES06443.1| hypothetical protein SORBIDRAFT_04g006380 [Sorghum bicolor] Length = 1652 Score = 56.6 bits (135), Expect(2) = 3e-16 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFYP 5 AQD TFR+ESVK L IIKSMG+WMD QL+IGDF P Sbjct: 462 AQDQTFRIESVKCLATIIKSMGSWMDQQLKIGDFSP 497 Score = 53.9 bits (128), Expect(2) = 3e-16 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 L D+FVNYDCDVDAPNIFER VNGLL Sbjct: 420 LIDIFVNYDCDVDAPNIFERVVNGLL 445 >gb|EXB40442.1| Brefeldin A-inhibited guanine nucleotide-exchange protein 1 [Morus notabilis] Length = 805 Score = 58.5 bits (140), Expect(2) = 4e-16 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFY 8 AQDITFR ESVK LV I+KSMGAWMD QLR+GD Y Sbjct: 435 AQDITFRHESVKCLVSIVKSMGAWMDQQLRLGDSY 469 Score = 51.6 bits (122), Expect(2) = 4e-16 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + D+FVNYDCDVD+PNIFER VNGLL Sbjct: 393 MIDIFVNYDCDVDSPNIFERIVNGLL 418 >ref|XP_007043107.1| SEC7-like guanine nucleotide exchange family protein [Theobroma cacao] gi|508707042|gb|EOX98938.1| SEC7-like guanine nucleotide exchange family protein [Theobroma cacao] Length = 1725 Score = 57.4 bits (137), Expect(2) = 8e-16 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 109 QDITFRLESVKFLVGIIKSMGAWMDLQLRIGD 14 QDITFR ESVK LVGIIKSMGAWMD QL+IGD Sbjct: 482 QDITFRHESVKCLVGIIKSMGAWMDQQLKIGD 513 Score = 51.6 bits (122), Expect(2) = 8e-16 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + D+FVNYDCDVD+PNIFER VNGLL Sbjct: 439 IIDIFVNYDCDVDSPNIFERIVNGLL 464 >ref|XP_006648411.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like, partial [Oryza brachyantha] Length = 1580 Score = 56.2 bits (134), Expect(2) = 8e-16 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFYP 5 AQD TFR+ESVK L IIKSMG+WMD QLRIG+F P Sbjct: 351 AQDQTFRIESVKCLATIIKSMGSWMDQQLRIGEFSP 386 Score = 52.8 bits (125), Expect(2) = 8e-16 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + DVFVNYDCDVDAPNIFER VNGLL Sbjct: 309 IVDVFVNYDCDVDAPNIFERIVNGLL 334 >ref|XP_006384870.1| guanine nucleotide exchange family protein [Populus trichocarpa] gi|550341638|gb|ERP62667.1| guanine nucleotide exchange family protein [Populus trichocarpa] Length = 1640 Score = 57.0 bits (136), Expect(2) = 1e-15 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 109 QDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFY 8 QDITFR ESVK LV II+SMGAWMD QLRIGD Y Sbjct: 469 QDITFRHESVKCLVSIIRSMGAWMDQQLRIGDSY 502 Score = 51.6 bits (122), Expect(2) = 1e-15 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + D+FVNYDCDVDAPNI+ER VNGLL Sbjct: 426 IIDIFVNYDCDVDAPNIYERIVNGLL 451 >dbj|BAD15400.1| putative guanine nucleotide-exchange protein GEP2 [Oryza sativa Japonica Group] Length = 1687 Score = 55.1 bits (131), Expect(2) = 1e-15 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFYP 5 AQD TFR+ESVK L IIKSMG+WMD QL+IG+F P Sbjct: 458 AQDQTFRIESVKCLATIIKSMGSWMDQQLKIGEFSP 493 Score = 53.1 bits (126), Expect(2) = 1e-15 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + DVFVNYDCDVDAPNIFER VNGLL Sbjct: 416 IIDVFVNYDCDVDAPNIFERIVNGLL 441 >gb|EEC72663.1| hypothetical protein OsI_06212 [Oryza sativa Indica Group] Length = 1641 Score = 55.1 bits (131), Expect(2) = 1e-15 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFYP 5 AQD TFR+ESVK L IIKSMG+WMD QL+IG+F P Sbjct: 455 AQDQTFRIESVKCLATIIKSMGSWMDQQLKIGEFSP 490 Score = 53.1 bits (126), Expect(2) = 1e-15 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + DVFVNYDCDVDAPNIFER VNGLL Sbjct: 413 IIDVFVNYDCDVDAPNIFERIVNGLL 438 >gb|EEE56489.1| hypothetical protein OsJ_05728 [Oryza sativa Japonica Group] Length = 1504 Score = 55.1 bits (131), Expect(2) = 1e-15 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFYP 5 AQD TFR+ESVK L IIKSMG+WMD QL+IG+F P Sbjct: 318 AQDQTFRIESVKCLATIIKSMGSWMDQQLKIGEFSP 353 Score = 53.1 bits (126), Expect(2) = 1e-15 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + DVFVNYDCDVDAPNIFER VNGLL Sbjct: 276 IIDVFVNYDCDVDAPNIFERIVNGLL 301 >ref|XP_003571170.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Brachypodium distachyon] Length = 1686 Score = 54.3 bits (129), Expect(2) = 2e-15 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFYP 5 AQD TFR+ESVK L I+KS+G+WMD QL+IGDF P Sbjct: 457 AQDQTFRIESVKCLATILKSIGSWMDQQLKIGDFSP 492 Score = 53.5 bits (127), Expect(2) = 2e-15 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 L D+FVNYDCDVDAPNIFER VNGLL Sbjct: 415 LIDIFVNYDCDVDAPNIFERIVNGLL 440 >ref|XP_006364333.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Solanum tuberosum] Length = 1720 Score = 55.5 bits (132), Expect(2) = 2e-15 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + DVFVNYDCDVDAPNIFERTVNGLL Sbjct: 439 IIDVFVNYDCDVDAPNIFERTVNGLL 464 Score = 52.4 bits (124), Expect(2) = 2e-15 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 109 QDITFRLESVKFLVGIIKSMGAWMDLQLRIGD 14 QDITFR ESVK LV IIKSMG WMD QL++GD Sbjct: 482 QDITFRSESVKCLVTIIKSMGMWMDQQLKVGD 513 >ref|XP_004231109.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Solanum lycopersicum] Length = 1716 Score = 55.5 bits (132), Expect(2) = 2e-15 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + DVFVNYDCDVDAPNIFERTVNGLL Sbjct: 439 IIDVFVNYDCDVDAPNIFERTVNGLL 464 Score = 52.4 bits (124), Expect(2) = 2e-15 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 109 QDITFRLESVKFLVGIIKSMGAWMDLQLRIGD 14 QDITFR ESVK LV IIKSMG WMD QL++GD Sbjct: 482 QDITFRSESVKCLVTIIKSMGMWMDQQLKVGD 513 >ref|XP_007142583.1| hypothetical protein PHAVU_008G293100g [Phaseolus vulgaris] gi|593573295|ref|XP_007142584.1| hypothetical protein PHAVU_008G293100g [Phaseolus vulgaris] gi|561015716|gb|ESW14577.1| hypothetical protein PHAVU_008G293100g [Phaseolus vulgaris] gi|561015717|gb|ESW14578.1| hypothetical protein PHAVU_008G293100g [Phaseolus vulgaris] Length = 1721 Score = 57.0 bits (136), Expect(2) = 4e-15 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGD 14 AQDITFR ESVK LV IIKSMGAWMD Q+RIGD Sbjct: 481 AQDITFRHESVKCLVSIIKSMGAWMDQQIRIGD 513 Score = 49.7 bits (117), Expect(2) = 4e-15 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + D+FVNYDCDVDA NIFER VNGLL Sbjct: 439 IIDIFVNYDCDVDASNIFERIVNGLL 464 >ref|XP_003519698.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like isoform 1 [Glycine max] Length = 1721 Score = 57.0 bits (136), Expect(2) = 4e-15 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGD 14 AQDITFR ESVK LV IIKSMGAWMD Q+RIGD Sbjct: 481 AQDITFRHESVKCLVSIIKSMGAWMDQQIRIGD 513 Score = 49.7 bits (117), Expect(2) = 4e-15 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + D+FVNYDCDVDA NIFER VNGLL Sbjct: 439 IIDIFVNYDCDVDASNIFERIVNGLL 464 >ref|XP_003544583.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like isoform X1 [Glycine max] Length = 1714 Score = 57.0 bits (136), Expect(2) = 4e-15 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGD 14 AQDITFR ESVK LV IIKSMGAWMD Q+RIGD Sbjct: 474 AQDITFRHESVKCLVSIIKSMGAWMDQQIRIGD 506 Score = 49.7 bits (117), Expect(2) = 4e-15 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + D+FVNYDCDVDA NIFER VNGLL Sbjct: 432 IIDIFVNYDCDVDASNIFERIVNGLL 457 >ref|XP_004965857.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Setaria italica] Length = 1699 Score = 55.5 bits (132), Expect(2) = 4e-15 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFYPS 2 AQD TFR+ESVK L I+KSM AWMD QLRIG+F PS Sbjct: 474 AQDQTFRIESVKCLATIMKSMSAWMDQQLRIGEFSPS 510 Score = 51.2 bits (121), Expect(2) = 4e-15 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + D+FVN+DCDVDAPNIFER VNGLL Sbjct: 432 IIDIFVNFDCDVDAPNIFERIVNGLL 457 >ref|XP_004491652.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Cicer arietinum] Length = 1683 Score = 57.0 bits (136), Expect(2) = 4e-15 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -1 Query: 112 AQDITFRLESVKFLVGIIKSMGAWMDLQLRIGDFY 8 AQDITFR ESVK LV IIKSMGAWMD Q+R GD Y Sbjct: 468 AQDITFRHESVKCLVSIIKSMGAWMDQQIRPGDLY 502 Score = 49.7 bits (117), Expect(2) = 4e-15 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -3 Query: 236 LFDVFVNYDCDVDAPNIFERTVNGLL 159 + D+FVNYDCDVDA NIFER VNGLL Sbjct: 426 IIDIFVNYDCDVDASNIFERIVNGLL 451