BLASTX nr result
ID: Akebia22_contig00021546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00021546 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006447438.1| hypothetical protein CICLE_v10018128mg [Citr... 56 6e-06 ref|XP_002281878.1| PREDICTED: calcium-binding protein PBP1 [Vit... 56 6e-06 >ref|XP_006447438.1| hypothetical protein CICLE_v10018128mg [Citrus clementina] gi|568830953|ref|XP_006469746.1| PREDICTED: calcium-binding protein PBP1-like [Citrus sinensis] gi|557550049|gb|ESR60678.1| hypothetical protein CICLE_v10018128mg [Citrus clementina] Length = 116 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 82 VDFEDFLPVMADKLGGEGLIGELCNGF 2 VDFED LPVMADKLGGEGLI ELCNGF Sbjct: 2 VDFEDLLPVMADKLGGEGLINELCNGF 28 >ref|XP_002281878.1| PREDICTED: calcium-binding protein PBP1 [Vitis vinifera] Length = 116 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 100 MAAQRTVDFEDFLPVMADKLGGEGLIGELCNGF 2 MAA + DFED LPVMA+KLGGEGLI ELCNGF Sbjct: 1 MAAPKMGDFEDLLPVMAEKLGGEGLIRELCNGF 33