BLASTX nr result
ID: Akebia22_contig00020286
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00020286 (666 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006852428.1| hypothetical protein AMTR_s00021p00076440 [A... 67 4e-09 ref|XP_007133199.1| hypothetical protein PHAVU_011G160000g [Phas... 66 9e-09 ref|XP_003556806.1| PREDICTED: TPR repeat-containing thioredoxin... 66 9e-09 ref|XP_006306910.1| hypothetical protein CARUB_v10008469mg [Caps... 66 1e-08 ref|NP_175737.1| TPR repeat-containing thioredoxin TTL1 [Arabido... 65 1e-08 ref|XP_002891741.1| hypothetical protein ARALYDRAFT_892363 [Arab... 65 1e-08 ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repea... 65 2e-08 ref|XP_002317465.1| tetratricopeptide repeat-containing family p... 65 2e-08 ref|XP_003525985.1| PREDICTED: TPR repeat-containing thioredoxin... 65 3e-08 ref|XP_006392803.1| hypothetical protein EUTSA_v10011281mg [Eutr... 64 3e-08 ref|XP_006348295.1| PREDICTED: TPR repeat-containing thioredoxin... 63 1e-07 ref|XP_007149399.1| hypothetical protein PHAVU_005G067000g [Phas... 63 1e-07 ref|XP_004968637.1| PREDICTED: TPR repeat-containing thioredoxin... 63 1e-07 ref|XP_007021713.1| Tetratricopetide-repeat thioredoxin-like 1 i... 63 1e-07 ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin... 63 1e-07 ref|NP_001042410.1| Os01g0218200 [Oryza sativa Japonica Group] g... 63 1e-07 ref|XP_002457127.1| hypothetical protein SORBIDRAFT_03g001720 [S... 63 1e-07 gb|EEE54122.1| hypothetical protein OsJ_00894 [Oryza sativa Japo... 63 1e-07 ref|NP_001130313.1| hypothetical protein [Zea mays] gi|194688818... 63 1e-07 ref|XP_006370168.1| hypothetical protein POPTR_0001s40310g [Popu... 62 2e-07 >ref|XP_006852428.1| hypothetical protein AMTR_s00021p00076440 [Amborella trichopoda] gi|548856039|gb|ERN13895.1| hypothetical protein AMTR_s00021p00076440 [Amborella trichopoda] Length = 671 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYSL 153 RIVPT KIYKNG RVKEMICP+ QVLEYSVRHYSL Sbjct: 637 RIVPTFKIYKNGCRVKEMICPTEQVLEYSVRHYSL 671 >ref|XP_007133199.1| hypothetical protein PHAVU_011G160000g [Phaseolus vulgaris] gi|561006199|gb|ESW05193.1| hypothetical protein PHAVU_011G160000g [Phaseolus vulgaris] Length = 679 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYSL 153 R+VPT KIYKNGSRVKE+ICPSH +LE+S+RHYSL Sbjct: 645 RVVPTFKIYKNGSRVKEIICPSHDMLEHSIRHYSL 679 >ref|XP_003556806.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 676 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYSL 153 R+VPT KIYKNGSRVKE+ICPSH +LE+S+RHYSL Sbjct: 642 RVVPTFKIYKNGSRVKEIICPSHDMLEHSIRHYSL 676 >ref|XP_006306910.1| hypothetical protein CARUB_v10008469mg [Capsella rubella] gi|482575621|gb|EOA39808.1| hypothetical protein CARUB_v10008469mg [Capsella rubella] Length = 695 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYS 150 R+VPT+KIYKNGSRVKE++CPS +VLEYSVRHYS Sbjct: 661 RVVPTVKIYKNGSRVKEIVCPSREVLEYSVRHYS 694 >ref|NP_175737.1| TPR repeat-containing thioredoxin TTL1 [Arabidopsis thaliana] gi|75336154|sp|Q9MAH1.1|TTL1_ARATH RecName: Full=TPR repeat-containing thioredoxin TTL1; AltName: Full=Tetratricopeptide repeat thioredoxin-like 1 gi|7769858|gb|AAF69536.1|AC008007_11 F12M16.20 [Arabidopsis thaliana] gi|30102668|gb|AAP21252.1| At1g53300 [Arabidopsis thaliana] gi|332194799|gb|AEE32920.1| TPR repeat-containing thioredoxin TTL1 [Arabidopsis thaliana] Length = 699 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYS 150 R+VPT+KIYKNGSRVKE++CPS +VLEYSVRHYS Sbjct: 665 RVVPTVKIYKNGSRVKEIVCPSKEVLEYSVRHYS 698 >ref|XP_002891741.1| hypothetical protein ARALYDRAFT_892363 [Arabidopsis lyrata subsp. lyrata] gi|297337583|gb|EFH68000.1| hypothetical protein ARALYDRAFT_892363 [Arabidopsis lyrata subsp. lyrata] Length = 688 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYS 150 R+VPT+KIYKNGSRVKE++CPS +VLEYSVRHYS Sbjct: 654 RVVPTVKIYKNGSRVKEIVCPSKEVLEYSVRHYS 687 >ref|XP_002524280.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] gi|223536471|gb|EEF38119.1| Small glutamine-rich tetratricopeptide repeat-containing protein A, putative [Ricinus communis] Length = 640 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYS 150 RIVPT KIYKNGSRVKE++CPSH +LE+SVRHYS Sbjct: 606 RIVPTFKIYKNGSRVKEIVCPSHDMLEHSVRHYS 639 >ref|XP_002317465.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] gi|222860530|gb|EEE98077.1| tetratricopeptide repeat-containing family protein [Populus trichocarpa] Length = 698 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYS 150 RIVPT KIYKNG+RVKE++CPSH VLE+SVRHYS Sbjct: 664 RIVPTFKIYKNGNRVKEIVCPSHDVLEHSVRHYS 697 >ref|XP_003525985.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Glycine max] Length = 678 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYSL 153 R+VPT KIYKNGS+VKE+ICPSH +LE+S+RHYSL Sbjct: 644 RVVPTFKIYKNGSQVKEIICPSHDMLEHSIRHYSL 678 >ref|XP_006392803.1| hypothetical protein EUTSA_v10011281mg [Eutrema salsugineum] gi|557089381|gb|ESQ30089.1| hypothetical protein EUTSA_v10011281mg [Eutrema salsugineum] Length = 689 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYS 150 R+VPT+KIYKNG+RVKE++CPS +VLEYSVRHYS Sbjct: 655 RVVPTVKIYKNGTRVKEIVCPSKEVLEYSVRHYS 688 >ref|XP_006348295.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Solanum tuberosum] Length = 700 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYSL 153 RIVPT KIYK GSRVKEMICPS +VLE SVRHYS+ Sbjct: 666 RIVPTFKIYKKGSRVKEMICPSQEVLESSVRHYSI 700 >ref|XP_007149399.1| hypothetical protein PHAVU_005G067000g [Phaseolus vulgaris] gi|561022663|gb|ESW21393.1| hypothetical protein PHAVU_005G067000g [Phaseolus vulgaris] Length = 688 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYS 150 RIVPT KIYKNGSRVKE++CPS ++LE+SVRHYS Sbjct: 654 RIVPTFKIYKNGSRVKEIVCPSREMLEHSVRHYS 687 >ref|XP_004968637.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Setaria italica] Length = 677 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYSL 153 R +PT KIYKNG RVKEMICPS Q+LEYSVRHY + Sbjct: 643 RTIPTFKIYKNGMRVKEMICPSQQLLEYSVRHYGI 677 >ref|XP_007021713.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 1 [Theobroma cacao] gi|508721341|gb|EOY13238.1| Tetratricopetide-repeat thioredoxin-like 1 isoform 1 [Theobroma cacao] Length = 698 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYS 150 RIVPT KIYKNGSRVKE++CPS ++LE+SVRHYS Sbjct: 664 RIVPTFKIYKNGSRVKEIVCPSREMLEHSVRHYS 697 >ref|XP_004244266.1| PREDICTED: TPR repeat-containing thioredoxin TTL1-like [Solanum lycopersicum] Length = 701 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYSL 153 RIVPT KIYK GSRVKEMICPS +VLE SVRHYS+ Sbjct: 667 RIVPTFKIYKKGSRVKEMICPSQEVLESSVRHYSI 701 >ref|NP_001042410.1| Os01g0218200 [Oryza sativa Japonica Group] gi|56201618|dbj|BAD73065.1| tetratricopeptide repeat protein -like [Oryza sativa Japonica Group] gi|56784083|dbj|BAD81412.1| tetratricopeptide repeat protein -like [Oryza sativa Japonica Group] gi|113531941|dbj|BAF04324.1| Os01g0218200 [Oryza sativa Japonica Group] Length = 672 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYSL 153 R VPT KIYKNG+RVKEMICPS Q+LEYSVRHY + Sbjct: 638 RTVPTFKIYKNGTRVKEMICPSLQLLEYSVRHYGI 672 >ref|XP_002457127.1| hypothetical protein SORBIDRAFT_03g001720 [Sorghum bicolor] gi|241929102|gb|EES02247.1| hypothetical protein SORBIDRAFT_03g001720 [Sorghum bicolor] Length = 684 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYSL 153 R +PT KIYKNG RVKEMICPS Q+LEYSVRHY + Sbjct: 650 RTIPTFKIYKNGMRVKEMICPSQQLLEYSVRHYGI 684 >gb|EEE54122.1| hypothetical protein OsJ_00894 [Oryza sativa Japonica Group] Length = 473 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYSL 153 R VPT KIYKNG+RVKEMICPS Q+LEYSVRHY + Sbjct: 439 RTVPTFKIYKNGTRVKEMICPSLQLLEYSVRHYGI 473 >ref|NP_001130313.1| hypothetical protein [Zea mays] gi|194688818|gb|ACF78493.1| unknown [Zea mays] gi|413947748|gb|AFW80397.1| hypothetical protein ZEAMMB73_358491 [Zea mays] Length = 675 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYSL 153 R VPT KIYKNG RVKEMICPS Q+LEYSVRHY + Sbjct: 641 RTVPTFKIYKNGIRVKEMICPSQQLLEYSVRHYGI 675 >ref|XP_006370168.1| hypothetical protein POPTR_0001s40310g [Populus trichocarpa] gi|550349347|gb|ERP66737.1| hypothetical protein POPTR_0001s40310g [Populus trichocarpa] Length = 688 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 49 RIVPTLKIYKNGSRVKEMICPSHQVLEYSVRHYS 150 RIVPT KIYKNGSRVKE++CPS +LE+SVRHYS Sbjct: 654 RIVPTFKIYKNGSRVKEIVCPSRDMLEHSVRHYS 687