BLASTX nr result
ID: Akebia22_contig00020169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00020169 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007202432.1| hypothetical protein PRUPE_ppa009843mg [Prun... 58 2e-06 ref|XP_007028027.1| Ribosomal protein L22p/L17e family protein [... 57 3e-06 ref|XP_006481625.1| PREDICTED: 50S ribosomal protein L22, chloro... 56 6e-06 ref|XP_006361742.1| PREDICTED: uncharacterized protein LOC102595... 56 6e-06 ref|XP_006430036.1| hypothetical protein CICLE_v10013709mg [Citr... 56 6e-06 >ref|XP_007202432.1| hypothetical protein PRUPE_ppa009843mg [Prunus persica] gi|462397963|gb|EMJ03631.1| hypothetical protein PRUPE_ppa009843mg [Prunus persica] Length = 275 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 298 LTKRESRLVPHKLIETTPVWNRKGKTQSRE 209 LTKRE RLVPHKLIETTP+WNRKGK + RE Sbjct: 240 LTKRERRLVPHKLIETTPIWNRKGKARERE 269 >ref|XP_007028027.1| Ribosomal protein L22p/L17e family protein [Theobroma cacao] gi|508716632|gb|EOY08529.1| Ribosomal protein L22p/L17e family protein [Theobroma cacao] Length = 275 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 298 LTKRESRLVPHKLIETTPVWNRKGKTQSREARPM 197 LTKRE RLVPHKLIETTP+WNRKGK S+E M Sbjct: 240 LTKRERRLVPHKLIETTPIWNRKGKGSSQEPSGM 273 >ref|XP_006481625.1| PREDICTED: 50S ribosomal protein L22, chloroplastic-like [Citrus sinensis] Length = 270 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 298 LTKRESRLVPHKLIETTPVWNRKGKTQSRE 209 LTKRE RLVPH+LIETTP+WNR+GK+ +RE Sbjct: 236 LTKREQRLVPHQLIETTPIWNRRGKSSNRE 265 >ref|XP_006361742.1| PREDICTED: uncharacterized protein LOC102595065 [Solanum tuberosum] Length = 392 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 298 LTKRESRLVPHKLIETTPVWNRKGKTQS 215 LTKRE RLVPHKLIETTP+WNRKGK +S Sbjct: 357 LTKREKRLVPHKLIETTPIWNRKGKVRS 384 >ref|XP_006430036.1| hypothetical protein CICLE_v10013709mg [Citrus clementina] gi|557532093|gb|ESR43276.1| hypothetical protein CICLE_v10013709mg [Citrus clementina] Length = 270 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 298 LTKRESRLVPHKLIETTPVWNRKGKTQSRE 209 LTKRE RLVPH+LIETTP+WNR+GK+ +RE Sbjct: 236 LTKREQRLVPHQLIETTPIWNRRGKSSNRE 265