BLASTX nr result
ID: Akebia22_contig00020142
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00020142 (362 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270851.2| PREDICTED: carbon catabolite repressor prote... 58 1e-06 emb|CBI29220.3| unnamed protein product [Vitis vinifera] 58 1e-06 gb|EXB53613.1| hypothetical protein L484_005163 [Morus notabilis] 56 6e-06 ref|XP_004300396.1| PREDICTED: carbon catabolite repressor prote... 56 6e-06 ref|XP_004246039.1| PREDICTED: carbon catabolite repressor prote... 56 6e-06 >ref|XP_002270851.2| PREDICTED: carbon catabolite repressor protein 4 homolog 4-like [Vitis vinifera] Length = 393 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 96 LQELDEYDNFYKGIMESNGYSSIYIQRGGQK 4 LQE+DEYD+FYKG M+SNGYSSIY+QR GQK Sbjct: 107 LQEVDEYDSFYKGNMDSNGYSSIYVQRSGQK 137 >emb|CBI29220.3| unnamed protein product [Vitis vinifera] Length = 393 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 96 LQELDEYDNFYKGIMESNGYSSIYIQRGGQK 4 LQE+DEYD+FYKG M+SNGYSSIY+QR GQK Sbjct: 107 LQEVDEYDSFYKGNMDSNGYSSIYVQRSGQK 137 >gb|EXB53613.1| hypothetical protein L484_005163 [Morus notabilis] Length = 389 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 96 LQELDEYDNFYKGIMESNGYSSIYIQRGGQKR 1 LQE+DEY++FYKG MES GYSSIYIQR GQKR Sbjct: 100 LQEVDEYESFYKGNMESCGYSSIYIQRTGQKR 131 >ref|XP_004300396.1| PREDICTED: carbon catabolite repressor protein 4 homolog 4-like [Fragaria vesca subsp. vesca] Length = 372 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 96 LQELDEYDNFYKGIMESNGYSSIYIQRGGQKR 1 LQE+DEY++FYKG ME NGYSS YIQR GQKR Sbjct: 82 LQEVDEYNSFYKGNMERNGYSSTYIQRSGQKR 113 >ref|XP_004246039.1| PREDICTED: carbon catabolite repressor protein 4 homolog 4-like [Solanum lycopersicum] Length = 389 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 96 LQELDEYDNFYKGIMESNGYSSIYIQRGGQKR 1 LQELDEYD+FYKG +ES GYSSIY++R GQKR Sbjct: 106 LQELDEYDSFYKGNIESVGYSSIYVKRNGQKR 137