BLASTX nr result
ID: Akebia22_contig00019708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00019708 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004161135.1| PREDICTED: uncharacterized LOC101214418 [Cuc... 55 8e-06 ref|XP_004147428.1| PREDICTED: uncharacterized protein LOC101214... 55 8e-06 ref|XP_002519756.1| vav3, putative [Ricinus communis] gi|2235411... 55 8e-06 >ref|XP_004161135.1| PREDICTED: uncharacterized LOC101214418 [Cucumis sativus] Length = 348 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +2 Query: 173 AGEVSRR*VRAREFPSPKNSSKLHAVESKMQELQANNGISGK 298 AGE+SRR R REF +P+N +KLHA E+KMQEL+AN + GK Sbjct: 168 AGEISRRRARVREFSNPENVAKLHASEAKMQELKANMAVLGK 209 >ref|XP_004147428.1| PREDICTED: uncharacterized protein LOC101214418 [Cucumis sativus] Length = 358 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +2 Query: 173 AGEVSRR*VRAREFPSPKNSSKLHAVESKMQELQANNGISGK 298 AGE+SRR R REF +P+N +KLHA E+KMQEL+AN + GK Sbjct: 178 AGEISRRRARVREFSNPENVAKLHASEAKMQELKANMAVLGK 219 >ref|XP_002519756.1| vav3, putative [Ricinus communis] gi|223541173|gb|EEF42729.1| vav3, putative [Ricinus communis] Length = 347 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 170 QAGEVSRR*VRAREFPSPKNSSKLHAVESKMQELQANNGISGK 298 QA EVSRR VR +E P P+N +KLHA E+KMQEL+AN + GK Sbjct: 167 QAAEVSRRQVRVKETPIPENVAKLHAAEAKMQELKANMAVLGK 209