BLASTX nr result
ID: Akebia22_contig00019522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00019522 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN34957.1| unknown [Zea mays] gi|413948347|gb|AFW80996.1| hy... 64 2e-08 gb|EYU28565.1| hypothetical protein MIMGU_mgv1a014401mg [Mimulus... 63 5e-08 ref|XP_004964659.1| PREDICTED: anaphase-promoting complex subuni... 63 5e-08 ref|XP_004961114.1| PREDICTED: anaphase-promoting complex subuni... 63 5e-08 ref|XP_004509275.1| PREDICTED: anaphase-promoting complex subuni... 63 5e-08 ref|XP_006298623.1| hypothetical protein CARUB_v10014711mg [Caps... 63 5e-08 gb|EMS68205.1| Anaphase-promoting complex subunit 10 [Triticum u... 63 5e-08 ref|XP_004287887.1| PREDICTED: anaphase-promoting complex subuni... 63 5e-08 ref|XP_004141108.1| PREDICTED: anaphase-promoting complex subuni... 63 5e-08 gb|AAM64688.1| unknown [Arabidopsis thaliana] 63 5e-08 ref|NP_565433.1| anaphase-promoting complex subunit 10 [Arabidop... 63 5e-08 gb|AFK44376.1| unknown [Medicago truncatula] 63 5e-08 gb|AFK37609.1| unknown [Lotus japonicus] 63 5e-08 ref|XP_003567816.1| PREDICTED: anaphase-promoting complex subuni... 63 5e-08 ref|XP_002886163.1| anaphase-promoting complex, subunit 10 famil... 63 5e-08 gb|ACR34072.1| unknown [Zea mays] gi|413948346|gb|AFW80995.1| hy... 63 5e-08 ref|XP_002310244.1| anaphase promoting complex subunit 10 family... 63 5e-08 ref|XP_006383182.1| anaphase promoting complex subunit 10 family... 63 5e-08 gb|ACL52734.1| unknown [Zea mays] gi|413948345|gb|AFW80994.1| an... 63 5e-08 ref|XP_006654839.1| PREDICTED: anaphase-promoting complex subuni... 62 6e-08 >gb|ACN34957.1| unknown [Zea mays] gi|413948347|gb|AFW80996.1| hypothetical protein ZEAMMB73_722151 [Zea mays] Length = 148 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLKV 92 VLYVDFKLDESYTPSKISIRAGDGFHNLKV Sbjct: 92 VLYVDFKLDESYTPSKISIRAGDGFHNLKV 121 >gb|EYU28565.1| hypothetical protein MIMGU_mgv1a014401mg [Mimulus guttatus] gi|604320672|gb|EYU31569.1| hypothetical protein MIMGU_mgv1a014378mg [Mimulus guttatus] Length = 191 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 82 VLYVDFKLDESYTPSKISIRAGDGFHNLK 110 >ref|XP_004964659.1| PREDICTED: anaphase-promoting complex subunit 10-like [Setaria italica] Length = 201 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 92 VLYVDFKLDESYTPSKISIRAGDGFHNLK 120 >ref|XP_004961114.1| PREDICTED: anaphase-promoting complex subunit 10-like [Setaria italica] Length = 201 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 92 VLYVDFKLDESYTPSKISIRAGDGFHNLK 120 >ref|XP_004509275.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X1 [Cicer arietinum] gi|502153259|ref|XP_004509276.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X2 [Cicer arietinum] gi|502153261|ref|XP_004509277.1| PREDICTED: anaphase-promoting complex subunit 10-like isoform X3 [Cicer arietinum] Length = 196 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 87 VLYVDFKLDESYTPSKISIRAGDGFHNLK 115 >ref|XP_006298623.1| hypothetical protein CARUB_v10014711mg [Capsella rubella] gi|482567332|gb|EOA31521.1| hypothetical protein CARUB_v10014711mg [Capsella rubella] Length = 192 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 83 VLYVDFKLDESYTPSKISIRAGDGFHNLK 111 >gb|EMS68205.1| Anaphase-promoting complex subunit 10 [Triticum urartu] Length = 199 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 86 VLYVDFKLDESYTPSKISIRAGDGFHNLK 114 >ref|XP_004287887.1| PREDICTED: anaphase-promoting complex subunit 10-like [Fragaria vesca subsp. vesca] Length = 191 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 82 VLYVDFKLDESYTPSKISIRAGDGFHNLK 110 >ref|XP_004141108.1| PREDICTED: anaphase-promoting complex subunit 10-like [Cucumis sativus] gi|449489479|ref|XP_004158324.1| PREDICTED: anaphase-promoting complex subunit 10-like [Cucumis sativus] Length = 192 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 83 VLYVDFKLDESYTPSKISIRAGDGFHNLK 111 >gb|AAM64688.1| unknown [Arabidopsis thaliana] Length = 192 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 83 VLYVDFKLDESYTPSKISIRAGDGFHNLK 111 >ref|NP_565433.1| anaphase-promoting complex subunit 10 [Arabidopsis thaliana] gi|34395513|sp|Q9ZPW2.2|APC10_ARATH RecName: Full=Anaphase-promoting complex subunit 10; Short=APC10; AltName: Full=Cyclosome subunit 10 gi|20197809|gb|AAD15507.2| expressed protein [Arabidopsis thaliana] gi|90567996|gb|ABD94068.1| At2g18290 [Arabidopsis thaliana] gi|110738941|dbj|BAF01391.1| hypothetical protein [Arabidopsis thaliana] gi|330251657|gb|AEC06751.1| anaphase-promoting complex subunit 10 [Arabidopsis thaliana] Length = 192 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 83 VLYVDFKLDESYTPSKISIRAGDGFHNLK 111 >gb|AFK44376.1| unknown [Medicago truncatula] Length = 196 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 87 VLYVDFKLDESYTPSKISIRAGDGFHNLK 115 >gb|AFK37609.1| unknown [Lotus japonicus] Length = 197 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 88 VLYVDFKLDESYTPSKISIRAGDGFHNLK 116 >ref|XP_003567816.1| PREDICTED: anaphase-promoting complex subunit 10-like [Brachypodium distachyon] Length = 205 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 96 VLYVDFKLDESYTPSKISIRAGDGFHNLK 124 >ref|XP_002886163.1| anaphase-promoting complex, subunit 10 family [Arabidopsis lyrata subsp. lyrata] gi|297332003|gb|EFH62422.1| anaphase-promoting complex, subunit 10 family [Arabidopsis lyrata subsp. lyrata] Length = 192 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 83 VLYVDFKLDESYTPSKISIRAGDGFHNLK 111 >gb|ACR34072.1| unknown [Zea mays] gi|413948346|gb|AFW80995.1| hypothetical protein ZEAMMB73_722151 [Zea mays] Length = 147 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 92 VLYVDFKLDESYTPSKISIRAGDGFHNLK 120 >ref|XP_002310244.1| anaphase promoting complex subunit 10 family protein [Populus trichocarpa] gi|222853147|gb|EEE90694.1| anaphase promoting complex subunit 10 family protein [Populus trichocarpa] Length = 192 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 83 VLYVDFKLDESYTPSKISIRAGDGFHNLK 111 >ref|XP_006383182.1| anaphase promoting complex subunit 10 family protein [Populus trichocarpa] gi|550338764|gb|ERP60979.1| anaphase promoting complex subunit 10 family protein [Populus trichocarpa] Length = 192 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 83 VLYVDFKLDESYTPSKISIRAGDGFHNLK 111 >gb|ACL52734.1| unknown [Zea mays] gi|413948345|gb|AFW80994.1| anaphase-promoting complex subunit 10 [Zea mays] Length = 201 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKISIRAGDGFHNLK Sbjct: 92 VLYVDFKLDESYTPSKISIRAGDGFHNLK 120 >ref|XP_006654839.1| PREDICTED: anaphase-promoting complex subunit 10-like [Oryza brachyantha] Length = 201 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +3 Query: 3 VLYVDFKLDESYTPSKISIRAGDGFHNLK 89 VLYVDFKLDESYTPSKIS+RAGDGFHNLK Sbjct: 92 VLYVDFKLDESYTPSKISVRAGDGFHNLK 120