BLASTX nr result
ID: Akebia22_contig00019507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00019507 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 55 6e-08 ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibi... 59 5e-07 ref|XP_007133039.1| hypothetical protein PHAVU_011G146200g [Phas... 58 1e-06 ref|XP_003616977.1| hypothetical protein MTR_5g086360 [Medicago ... 58 1e-06 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 54.7 bits (130), Expect(3) = 6e-08 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 46 RHHLVILPLS*AGSVRCSVKPASRGVLRSKNRLTQAFAR 162 RH LVILPL AG RCSVKPASR LRS+N++T AFA+ Sbjct: 16 RHQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQ 54 Score = 23.9 bits (50), Expect(3) = 6e-08 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 159 KNQLAQLTTWNGRVR 203 + +AQL+ WNGR R Sbjct: 54 QGHIAQLSAWNGRAR 68 Score = 23.1 bits (48), Expect(3) = 6e-08 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 230 SGSNQCPTTLMPPLGLQAN 286 +G Q P TLMP L LQA+ Sbjct: 77 TGPEQRPITLMPLLRLQAH 95 >ref|XP_007035646.1| Plant invertase/pectin methylesterase inhibitor superfamily, putative [Theobroma cacao] gi|508714675|gb|EOY06572.1| Plant invertase/pectin methylesterase inhibitor superfamily, putative [Theobroma cacao] Length = 686 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/52 (61%), Positives = 36/52 (69%) Frame = +1 Query: 49 HHLVILPLS*AGSVRCSVKPASRGVLRSKNRLTQAFARIN*LNSQLGTGESE 204 H LVILPL S RCSVKPASRG L S+N+ QA+AR N QLGTG+ E Sbjct: 2 HWLVILPLFVTESFRCSVKPASRGALLSRNQEAQAYARTPWFNYQLGTGKPE 53 >ref|XP_007133039.1| hypothetical protein PHAVU_011G146200g [Phaseolus vulgaris] gi|561006039|gb|ESW05033.1| hypothetical protein PHAVU_011G146200g [Phaseolus vulgaris] Length = 93 Score = 58.2 bits (139), Expect = 1e-06 Identities = 37/75 (49%), Positives = 45/75 (60%) Frame = +1 Query: 58 VILPLS*AGSVRCSVKPASRGVLRSKNRLTQAFARIN*LNSQLGTGESEFASNQS*PFRI 237 VILPL G RCSVKPASR L SK++ T AF ++ LNSQLG G + S + Sbjct: 5 VILPLLGMGGGRCSVKPASRCALHSKSQETLAFTKVPRLNSQLGVGRPTNCKH-SPTQQA 63 Query: 238 QPMSNHLNAPTRVTS 282 + +H NAPT VTS Sbjct: 64 SMLFHHSNAPTWVTS 78 >ref|XP_003616977.1| hypothetical protein MTR_5g086360 [Medicago truncatula] gi|355518312|gb|AES99935.1| hypothetical protein MTR_5g086360 [Medicago truncatula] Length = 81 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/58 (55%), Positives = 39/58 (67%) Frame = +1 Query: 55 LVILPLS*AGSVRCSVKPASRGVLRSKNRLTQAFARIN*LNSQLGTGESEFASNQS*P 228 LVI PLS A +RCS KPASR L S+N+ T+AFA+I NSQLG G+ + NQ P Sbjct: 15 LVIPPLSRARGLRCSAKPASRSALSSRNQETKAFAQIPWPNSQLGEGKPTYCRNQPSP 72