BLASTX nr result
ID: Akebia22_contig00018801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00018801 (450 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532295.1| geranylgeranyl transferase type I beta subun... 60 4e-07 ref|XP_004307531.1| PREDICTED: geranylgeranyl transferase type-1... 59 5e-07 >ref|XP_002532295.1| geranylgeranyl transferase type I beta subunit, putative [Ricinus communis] gi|223527997|gb|EEF30079.1| geranylgeranyl transferase type I beta subunit, putative [Ricinus communis] Length = 370 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 449 HSYYGFTAFSLLEEPDLELLCVELGITEVAAIG 351 HSYYG+TAFSLLEEP L LCVELGIT+VAA+G Sbjct: 337 HSYYGYTAFSLLEEPGLNSLCVELGITDVAALG 369 >ref|XP_004307531.1| PREDICTED: geranylgeranyl transferase type-1 subunit beta-like [Fragaria vesca subsp. vesca] Length = 348 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 449 HSYYGFTAFSLLEEPDLELLCVELGITEVAAIG 351 HSYYGFTAFSLLEEP L LCVELG+T++AAIG Sbjct: 315 HSYYGFTAFSLLEEPGLSSLCVELGMTDLAAIG 347