BLASTX nr result
ID: Akebia22_contig00018783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00018783 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF14952.1| hypothetical protein SEPMUDRAFT_146962 [Sphaeruli... 79 7e-13 >gb|EMF14952.1| hypothetical protein SEPMUDRAFT_146962 [Sphaerulina musiva SO2202] Length = 714 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 3 RSRPPGNTGLNSNGISFNNDSSDDGIDTRRDTQVKVV 113 RSRPPGNTGLNSNGISFNNDSSDDGIDTRRDTQVKVV Sbjct: 62 RSRPPGNTGLNSNGISFNNDSSDDGIDTRRDTQVKVV 98