BLASTX nr result
ID: Akebia22_contig00018690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00018690 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_849444.1| ACD1-like protein [Arabidopsis thaliana] gi|752... 59 5e-07 emb|CAB43696.1| putative protein [Arabidopsis thaliana] gi|72694... 57 2e-06 ref|NP_567725.1| ACD1-like protein [Arabidopsis thaliana] gi|159... 57 3e-06 ref|XP_007208467.1| hypothetical protein PRUPE_ppa004005mg [Prun... 56 5e-06 ref|XP_006413285.1| hypothetical protein EUTSA_v10024869mg [Eutr... 55 8e-06 >ref|NP_849444.1| ACD1-like protein [Arabidopsis thaliana] gi|75248733|sp|Q8W496.1|PTC52_ARATH RecName: Full=Protochlorophyllide-dependent translocon component 52, chloroplastic; AltName: Full=ACD1-like protein; AltName: Full=Protein TIC 55-IV; AltName: Full=Translocon at the inner envelope membrane of chloroplasts 55-IV; Flags: Precursor gi|17065310|gb|AAL32809.1| Unknown protein [Arabidopsis thaliana] gi|27311961|gb|AAO00946.1| Unknown protein [Arabidopsis thaliana] gi|332659689|gb|AEE85089.1| ACD1-like protein [Arabidopsis thaliana] Length = 559 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 3/56 (5%) Frame = -3 Query: 339 CVCHVCI---TEI*FYFTPKADREGGTPMEINVETLDIKGFLAKQENGYAKFISPC 181 C+ + C T + K DREGG P+EINV+ LD KGF +KQE GY+ FI+PC Sbjct: 269 CISNSCFNPFTNLQILLAEKIDREGGKPLEINVKKLDNKGFFSKQEWGYSNFIAPC 324 >emb|CAB43696.1| putative protein [Arabidopsis thaliana] gi|7269415|emb|CAB81375.1| putative protein [Arabidopsis thaliana] Length = 548 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = -3 Query: 342 FCVCHVCITEI*FYFTPKADREGGTPMEINVETLDIKGFLAKQENGYAKFISPC 181 F +C + + E K DREGG P+EINV+ LD KGF +KQE GY+ FI+PC Sbjct: 267 FQLCVILLAE-------KIDREGGKPLEINVKKLDNKGFFSKQEWGYSNFIAPC 313 >ref|NP_567725.1| ACD1-like protein [Arabidopsis thaliana] gi|15983402|gb|AAL11569.1|AF424575_1 AT4g25650/L73G19_30 [Arabidopsis thaliana] gi|15810259|gb|AAL07017.1| unknown protein [Arabidopsis thaliana] gi|37962888|gb|AAR05798.1| LLS1-like protein [Arabidopsis thaliana] gi|332659688|gb|AEE85088.1| ACD1-like protein [Arabidopsis thaliana] Length = 536 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -3 Query: 291 KADREGGTPMEINVETLDIKGFLAKQENGYAKFISPC 181 K DREGG P+EINV+ LD KGF +KQE GY+ FI+PC Sbjct: 265 KIDREGGKPLEINVKKLDNKGFFSKQEWGYSNFIAPC 301 >ref|XP_007208467.1| hypothetical protein PRUPE_ppa004005mg [Prunus persica] gi|462404109|gb|EMJ09666.1| hypothetical protein PRUPE_ppa004005mg [Prunus persica] Length = 536 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -3 Query: 291 KADREGGTPMEINVETLDIKGFLAKQENGYAKFISPC 181 KADREGG P+E++V+ LDI GF+AKQE G +KF+ PC Sbjct: 266 KADREGGRPLELSVQKLDINGFIAKQEWGRSKFLPPC 302 >ref|XP_006413285.1| hypothetical protein EUTSA_v10024869mg [Eutrema salsugineum] gi|557114455|gb|ESQ54738.1| hypothetical protein EUTSA_v10024869mg [Eutrema salsugineum] Length = 539 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -3 Query: 291 KADREGGTPMEINVETLDIKGFLAKQENGYAKFISPC 181 K DREGG P+EI V+ LD +GF AKQE GYA FI+PC Sbjct: 268 KIDREGGKPLEITVKRLDNEGFFAKQEWGYANFIAPC 304