BLASTX nr result
ID: Akebia22_contig00018679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00018679 (210 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30232.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002283772.1| PREDICTED: cytochrome P450 76A2 [Vitis vinif... 57 3e-06 emb|CAN76784.1| hypothetical protein VITISV_028823 [Vitis vinifera] 57 3e-06 >emb|CBI30232.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 3 EWELEHGLSPETIDMNDRIGFTLRKATPLKAKPRKR 110 +WEL L+PETIDMN+R+G TLRK PLKA PRKR Sbjct: 390 DWELGSNLTPETIDMNERVGLTLRKLVPLKAIPRKR 425 >ref|XP_002283772.1| PREDICTED: cytochrome P450 76A2 [Vitis vinifera] Length = 511 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 3 EWELEHGLSPETIDMNDRIGFTLRKATPLKAKPRKR 110 +WEL L+PETIDMN+R+G TLRK PLKA PRKR Sbjct: 471 DWELGSNLTPETIDMNERVGLTLRKLVPLKAIPRKR 506 >emb|CAN76784.1| hypothetical protein VITISV_028823 [Vitis vinifera] Length = 511 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +3 Query: 3 EWELEHGLSPETIDMNDRIGFTLRKATPLKAKPRKR 110 +WEL L+PETIDMN+R+G TLRK PLKA PRKR Sbjct: 471 DWELGSNLTPETIDMNERVGLTLRKLVPLKAIPRKR 506