BLASTX nr result
ID: Akebia22_contig00017235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00017235 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006849096.1| hypothetical protein AMTR_s00028p00239040 [A... 70 3e-10 ref|XP_002518430.1| receptor protein kinase, putative [Ricinus c... 69 5e-10 ref|XP_002525309.1| receptor protein kinase, putative [Ricinus c... 69 9e-10 emb|CDH30701.1| putative LysM domain containing receptor kinase ... 68 1e-09 ref|XP_006829559.1| hypothetical protein AMTR_s00074p00174510 [A... 68 1e-09 ref|XP_002270987.2| PREDICTED: proline-rich receptor-like protei... 67 2e-09 emb|CBI28844.3| unnamed protein product [Vitis vinifera] 67 2e-09 emb|CAN62472.1| hypothetical protein VITISV_005320 [Vitis vinifera] 67 2e-09 ref|XP_002264327.2| PREDICTED: proline-rich receptor-like protei... 67 3e-09 emb|CBI23197.3| unnamed protein product [Vitis vinifera] 67 3e-09 ref|XP_002301610.1| LysM domain-containing receptor-like kinase ... 67 3e-09 emb|CAN68636.1| hypothetical protein VITISV_030803 [Vitis vinifera] 67 3e-09 gb|EXB77037.1| Proline-rich receptor-like protein kinase PERK8 [... 67 3e-09 ref|XP_007049133.1| Chitin elicitor receptor kinase 1, RLK1 isof... 67 3e-09 ref|XP_002317145.2| hypothetical protein POPTR_0011s01470g [Popu... 66 4e-09 ref|XP_004144507.1| PREDICTED: proline-rich receptor-like protei... 66 4e-09 ref|XP_007026165.1| Chitin elicitor receptor kinase 1, RLK1 [The... 66 6e-09 ref|XP_006597595.1| PREDICTED: chitin elicitor receptor kinase 1... 65 7e-09 ref|XP_007147690.1| hypothetical protein PHAVU_006G146400g [Phas... 65 7e-09 ref|XP_004159205.1| PREDICTED: proline-rich receptor-like protei... 65 7e-09 >ref|XP_006849096.1| hypothetical protein AMTR_s00028p00239040 [Amborella trichopoda] gi|548852569|gb|ERN10677.1| hypothetical protein AMTR_s00028p00239040 [Amborella trichopoda] Length = 373 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 QLAKACTQENP+LRPSMR +VVAL LSS+ EDW+ SL+ENQAL++L+S Sbjct: 322 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSLYENQALVNLMS 371 >ref|XP_002518430.1| receptor protein kinase, putative [Ricinus communis] gi|223542275|gb|EEF43817.1| receptor protein kinase, putative [Ricinus communis] Length = 607 Score = 69.3 bits (168), Expect = 5e-10 Identities = 35/50 (70%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 QLAKACTQENP+LRPSMR +VVAL LSS+ EDW+ +L+ENQAL++L+S Sbjct: 556 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGTLYENQALLNLMS 605 >ref|XP_002525309.1| receptor protein kinase, putative [Ricinus communis] gi|223535368|gb|EEF37042.1| receptor protein kinase, putative [Ricinus communis] Length = 603 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 QLAKACTQENP+LRPSMR +VVAL LSS+ EDW+ S +ENQAL++L+S Sbjct: 552 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMS 601 >emb|CDH30701.1| putative LysM domain containing receptor kinase [Cercis chinensis] Length = 637 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 QLAKACTQ+NP+LRPSMR +VVAL LSSN EDW+ S ++NQAL++L+S Sbjct: 586 QLAKACTQDNPQLRPSMRSIVVALMTLSSNTEDWDVGSFYDNQALVNLMS 635 >ref|XP_006829559.1| hypothetical protein AMTR_s00074p00174510 [Amborella trichopoda] gi|548835043|gb|ERM96975.1| hypothetical protein AMTR_s00074p00174510 [Amborella trichopoda] Length = 123 Score = 67.8 bits (164), Expect = 1e-09 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVAL-TALSSNEDWNPLSLFENQALMSLIS 147 QLAKACTQENP+LRPSMR +VVAL T SS EDW+ S +ENQAL++L+S Sbjct: 73 QLAKACTQENPQLRPSMRSIVVALMTHSSSTEDWDVGSFYENQALLNLMS 122 >ref|XP_002270987.2| PREDICTED: proline-rich receptor-like protein kinase PERK13-like [Vitis vinifera] Length = 619 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 QLAKACTQENP+LRPSMR +VVAL LSS+ EDW+ S ++NQAL++L+S Sbjct: 568 QLAKACTQENPQLRPSMRTIVVALMTLSSSTEDWDVGSFYDNQALVNLMS 617 >emb|CBI28844.3| unnamed protein product [Vitis vinifera] Length = 625 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 QLAKACTQENP+LRPSMR +VVAL LSS+ EDW+ S ++NQAL++L+S Sbjct: 574 QLAKACTQENPQLRPSMRTIVVALMTLSSSTEDWDVGSFYDNQALVNLMS 623 >emb|CAN62472.1| hypothetical protein VITISV_005320 [Vitis vinifera] Length = 596 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 QLAKACTQENP+LRPSMR +VVAL LSS+ EDW+ S ++NQAL++L+S Sbjct: 529 QLAKACTQENPQLRPSMRTIVVALMTLSSSTEDWDVGSFYDNQALVNLMS 578 >ref|XP_002264327.2| PREDICTED: proline-rich receptor-like protein kinase PERK13-like [Vitis vinifera] Length = 619 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/49 (69%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = +1 Query: 4 LAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 LAKACTQENP+LRPSMR +VVAL LSS+ EDW+ S +EN+ALM+L+S Sbjct: 569 LAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENEALMNLMS 617 >emb|CBI23197.3| unnamed protein product [Vitis vinifera] Length = 650 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/49 (69%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = +1 Query: 4 LAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 LAKACTQENP+LRPSMR +VVAL LSS+ EDW+ S +EN+ALM+L+S Sbjct: 600 LAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENEALMNLMS 648 >ref|XP_002301610.1| LysM domain-containing receptor-like kinase 4 family protein [Populus trichocarpa] gi|222843336|gb|EEE80883.1| LysM domain-containing receptor-like kinase 4 family protein [Populus trichocarpa] Length = 581 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 QL KACTQENP+LRPSMR +VVAL LSS+ EDW+ S +ENQAL++L+S Sbjct: 530 QLGKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENQALVNLMS 579 >emb|CAN68636.1| hypothetical protein VITISV_030803 [Vitis vinifera] Length = 2252 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/49 (69%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = +1 Query: 4 LAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 LAKACTQENP+LRPSMR +VVAL LSS+ EDW+ S +EN+ALM+L+S Sbjct: 1610 LAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENEALMNLMS 1658 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/50 (66%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 QLAKACTQE+P+LRPSM+ VVVAL LSS+ EDW+ S++EN+AL++L+S Sbjct: 2201 QLAKACTQEDPQLRPSMQSVVVALMTLSSSTEDWDVRSVYENKALVNLMS 2250 >gb|EXB77037.1| Proline-rich receptor-like protein kinase PERK8 [Morus notabilis] Length = 608 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/50 (68%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSS-NEDWNPLSLFENQALMSLIS 147 QLAKACTQE+P+LRPSMR +VVAL LSS EDW+ SL++NQAL++L+S Sbjct: 557 QLAKACTQESPQLRPSMRSIVVALMTLSSTTEDWDVGSLYDNQALVNLMS 606 >ref|XP_007049133.1| Chitin elicitor receptor kinase 1, RLK1 isoform 1 [Theobroma cacao] gi|590711533|ref|XP_007049134.1| Chitin elicitor receptor kinase 1, RLK1 isoform 1 [Theobroma cacao] gi|508701394|gb|EOX93290.1| Chitin elicitor receptor kinase 1, RLK1 isoform 1 [Theobroma cacao] gi|508701395|gb|EOX93291.1| Chitin elicitor receptor kinase 1, RLK1 isoform 1 [Theobroma cacao] Length = 297 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/50 (68%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 QLAKACTQENP+LRPSMR +VVAL LSS+ EDW+ S +EN AL++L+S Sbjct: 246 QLAKACTQENPQLRPSMRSIVVALMTLSSSTEDWDVGSFYENHALVNLMS 295 >ref|XP_002317145.2| hypothetical protein POPTR_0011s01470g [Populus trichocarpa] gi|550327324|gb|EEE97757.2| hypothetical protein POPTR_0011s01470g [Populus trichocarpa] Length = 607 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/50 (66%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSSN-EDWNPLSLFENQALMSLIS 147 QLA+ACTQENP +RPSMR +VVAL LSS+ EDW+ SL+ENQA++ L+S Sbjct: 556 QLARACTQENPHVRPSMRSIVVALMTLSSSTEDWDVGSLYENQAIVDLMS 605 >ref|XP_004144507.1| PREDICTED: proline-rich receptor-like protein kinase PERK8-like [Cucumis sativus] Length = 603 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSS-NEDWNPLSLFENQALMSLIS 147 QLAKACT ENP+LRPSMR +VVAL LSS EDW+ S +ENQAL++L+S Sbjct: 552 QLAKACTHENPQLRPSMRSIVVALMTLSSATEDWDVGSFYENQALVNLMS 601 >ref|XP_007026165.1| Chitin elicitor receptor kinase 1, RLK1 [Theobroma cacao] gi|508781531|gb|EOY28787.1| Chitin elicitor receptor kinase 1, RLK1 [Theobroma cacao] Length = 674 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/49 (67%), Positives = 44/49 (89%), Gaps = 1/49 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTAL-SSNEDWNPLSLFENQALMSLI 144 +LA+ACTQENP+LRPSMR +VVAL AL SS+EDW+ SL+EN+AL++L+ Sbjct: 623 RLARACTQENPQLRPSMRSIVVALMALSSSSEDWDVGSLYENKALINLM 671 >ref|XP_006597595.1| PREDICTED: chitin elicitor receptor kinase 1-like isoform X2 [Glycine max] Length = 627 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSS-NEDWNPLSLFENQALMSLIS 147 QLAKACT ENP+LRPSMR +VVAL LSS EDW+ S +ENQAL+ L+S Sbjct: 576 QLAKACTHENPQLRPSMRSIVVALMTLSSATEDWDVGSFYENQALVHLMS 625 >ref|XP_007147690.1| hypothetical protein PHAVU_006G146400g [Phaseolus vulgaris] gi|561020913|gb|ESW19684.1| hypothetical protein PHAVU_006G146400g [Phaseolus vulgaris] Length = 624 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSS-NEDWNPLSLFENQALMSLIS 147 QLAKACT ENP+LRPSMR +VVAL LSS EDW+ S +ENQAL+ L+S Sbjct: 573 QLAKACTHENPQLRPSMRSIVVALMTLSSATEDWDVGSFYENQALVHLMS 622 >ref|XP_004159205.1| PREDICTED: proline-rich receptor-like protein kinase PERK8-like [Cucumis sativus] Length = 603 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/50 (66%), Positives = 41/50 (82%), Gaps = 1/50 (2%) Frame = +1 Query: 1 QLAKACTQENPRLRPSMRFVVVALTALSS-NEDWNPLSLFENQALMSLIS 147 QLAKACT ENP+LRPSMR +VVAL LSS EDW+ S +ENQAL++++S Sbjct: 552 QLAKACTHENPQLRPSMRSIVVALMTLSSATEDWDVGSFYENQALVNMMS 601