BLASTX nr result
ID: Akebia22_contig00016991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00016991 (509 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510555.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002510555.1| conserved hypothetical protein [Ricinus communis] gi|223551256|gb|EEF52742.1| conserved hypothetical protein [Ricinus communis] Length = 1005 Score = 55.8 bits (133), Expect = 6e-06 Identities = 43/116 (37%), Positives = 55/116 (47%), Gaps = 5/116 (4%) Frame = -1 Query: 470 ILIDKERSVSSGIVTTIETLVQHKNSGVHKKAKILYDCWKGNNNDPAVNFSTTVKGSAVE 291 +L DKERSVSSGI TI L+ H +S V +A+ LYD WK + D A + G A Sbjct: 100 LLXDKERSVSSGIWITINNLLHHSSSRVQDRARALYDSWKQDRVDDAYHHDVQTLG-ASR 158 Query: 290 DKHVV--ESVGSESHHQDVSDTTPSQLIEK---DGSCQEGLSIMEESTIKARLSDV 138 D V+ E+ G+E DV S +E D S L S R+ DV Sbjct: 159 DASVLSSENSGAECAAMDVPLPRGSADVENNVADSSTDVNLQSNSNSLHLERVEDV 214