BLASTX nr result
ID: Akebia22_contig00016667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00016667 (474 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007031540.1| Cysteine-rich RLK 42 [Theobroma cacao] gi|50... 72 6e-11 gb|EXC20318.1| Cysteine-rich receptor-like protein kinase 42 [Mo... 62 6e-08 ref|XP_002511372.1| BRASSINOSTEROID INSENSITIVE 1-associated rec... 62 6e-08 ref|XP_002517692.1| conserved hypothetical protein [Ricinus comm... 62 8e-08 ref|XP_007036266.1| Cysteine-rich RLK 42, putative [Theobroma ca... 62 1e-07 gb|EXB90356.1| Cysteine-rich receptor-like protein kinase 42 [Mo... 59 5e-07 emb|CBI15002.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_002278823.1| PREDICTED: cysteine-rich receptor-like prote... 59 7e-07 emb|CAN61087.1| hypothetical protein VITISV_034611 [Vitis vinifera] 59 7e-07 ref|XP_002318677.2| hypothetical protein POPTR_0012s08890g, part... 58 1e-06 ref|XP_002524667.1| kinase, putative [Ricinus communis] gi|22353... 58 2e-06 ref|XP_002300041.2| hypothetical protein POPTR_0001s35060g [Popu... 56 4e-06 ref|XP_007211016.1| hypothetical protein PRUPE_ppa020522mg [Prun... 56 4e-06 ref|XP_006470280.1| PREDICTED: cysteine-rich receptor-like prote... 56 6e-06 ref|XP_006446554.1| hypothetical protein CICLE_v10014520mg [Citr... 56 6e-06 ref|XP_006841049.1| hypothetical protein AMTR_s00085p00156760 [A... 56 6e-06 >ref|XP_007031540.1| Cysteine-rich RLK 42 [Theobroma cacao] gi|508710569|gb|EOY02466.1| Cysteine-rich RLK 42 [Theobroma cacao] Length = 665 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = +1 Query: 1 VSLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVTASSASN 156 VSLRP M +VVQMLTDKDC+IP P QPPFLNASV+DP ++T S T S +N Sbjct: 587 VSLRPSMAQVVQMLTDKDCEIPSPNQPPFLNASVLDPTSSTRSNSTDSFTTN 638 >gb|EXC20318.1| Cysteine-rich receptor-like protein kinase 42 [Morus notabilis] Length = 664 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = +1 Query: 1 VSLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVTASSASN 156 V+LRP M EVV MLT+ + +IP P QPPFLNASV+ P T++ S+ T S SN Sbjct: 586 VALRPSMAEVVSMLTNNEKEIPTPNQPPFLNASVLGPTTSSKSYSTQSMVSN 637 >ref|XP_002511372.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] gi|223550487|gb|EEF51974.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative [Ricinus communis] Length = 614 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = +1 Query: 4 SLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVTASS 147 SLRP M EVV+MLT+K+C+IP PMQPPFLNASV+ +T + +T S Sbjct: 522 SLRPSMTEVVEMLTNKECEIPTPMQPPFLNASVLSAGGSTENSITKVS 569 >ref|XP_002517692.1| conserved hypothetical protein [Ricinus communis] gi|223543324|gb|EEF44856.1| conserved hypothetical protein [Ricinus communis] Length = 142 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/55 (52%), Positives = 39/55 (70%) Frame = +1 Query: 1 VSLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVTASSASNGPI 165 V+LRP M EVV MLT C+IPLP Q PFLNA++++P ++ S+ T+S SN I Sbjct: 60 VALRPSMTEVVVMLTSSGCEIPLPSQTPFLNATLVEPESSKRSYCTSSFVSNAAI 114 >ref|XP_007036266.1| Cysteine-rich RLK 42, putative [Theobroma cacao] gi|508773511|gb|EOY20767.1| Cysteine-rich RLK 42, putative [Theobroma cacao] Length = 649 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +1 Query: 4 SLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTT 120 +LRP M EVVQMLTDK C+IP P QPPFLNASV+ P T Sbjct: 577 ALRPSMAEVVQMLTDKSCEIPSPKQPPFLNASVLSPEDT 615 >gb|EXB90356.1| Cysteine-rich receptor-like protein kinase 42 [Morus notabilis] Length = 652 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/38 (68%), Positives = 35/38 (92%) Frame = +1 Query: 1 VSLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPN 114 V+LRP M EVVQML+D++ +IPLPMQPPFLNAS+++P+ Sbjct: 581 VALRPSMSEVVQMLSDREHEIPLPMQPPFLNASILNPD 618 >emb|CBI15002.3| unnamed protein product [Vitis vinifera] Length = 696 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +1 Query: 4 SLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVT 138 +LRP M +VVQMLTD++ IP PMQPPFLNASV+DP+ + + +T Sbjct: 563 ALRPSMSQVVQMLTDQNSVIPEPMQPPFLNASVLDPSNSLKNSIT 607 >ref|XP_002278823.1| PREDICTED: cysteine-rich receptor-like protein kinase 1-like [Vitis vinifera] Length = 611 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +1 Query: 4 SLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVT 138 +LRP M +VVQMLTD++ IP PMQPPFLNASV+DP+ + + +T Sbjct: 526 ALRPSMSQVVQMLTDQNSVIPEPMQPPFLNASVLDPSNSLKNSIT 570 >emb|CAN61087.1| hypothetical protein VITISV_034611 [Vitis vinifera] Length = 668 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = +1 Query: 4 SLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVT 138 +LRP M +VVQMLTD++ IP PMQPPFLNASV+DP+ + + +T Sbjct: 569 ALRPSMSQVVQMLTDQNSVIPEPMQPPFLNASVLDPSNSLKNSIT 613 >ref|XP_002318677.2| hypothetical protein POPTR_0012s08890g, partial [Populus trichocarpa] gi|550326693|gb|EEE96897.2| hypothetical protein POPTR_0012s08890g, partial [Populus trichocarpa] Length = 583 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = +1 Query: 7 LRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVTASS 147 LRP M EVVQMLTD C+IP P QPPFLNASV+ P+ S +T S Sbjct: 509 LRPSMNEVVQMLTDAQCEIPSPKQPPFLNASVLSPDGGADSCITEVS 555 >ref|XP_002524667.1| kinase, putative [Ricinus communis] gi|223536028|gb|EEF37686.1| kinase, putative [Ricinus communis] Length = 605 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = +1 Query: 1 VSLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVTASSASN 156 V+LRP M EVV MLT+ +IPLP QPPF+NA+ ++P ++ S+ T+S SN Sbjct: 521 VALRPSMAEVVVMLTNSGGEIPLPSQPPFMNATSLEPESSRRSYSTSSFVSN 572 >ref|XP_002300041.2| hypothetical protein POPTR_0001s35060g [Populus trichocarpa] gi|550348917|gb|EEE84846.2| hypothetical protein POPTR_0001s35060g [Populus trichocarpa] Length = 667 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/55 (43%), Positives = 36/55 (65%) Frame = +1 Query: 4 SLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVTASSASNGPID 168 +LRP M +VV LT+ DC+IP P QPP++N S+++ + S+ S SNGP + Sbjct: 586 ALRPSMAQVVHFLTNNDCEIPPPNQPPYMNTSLLETENSRWSYSINSLVSNGPTE 640 >ref|XP_007211016.1| hypothetical protein PRUPE_ppa020522mg [Prunus persica] gi|462406751|gb|EMJ12215.1| hypothetical protein PRUPE_ppa020522mg [Prunus persica] Length = 633 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/46 (56%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = +1 Query: 1 VSLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVM--DPNTTTMSF 132 +++RP M EVVQMLTDK+C IP P +PPFLNAS++ D + T+M + Sbjct: 564 LAVRPSMTEVVQMLTDKECVIPSPKRPPFLNASILSSDVSRTSMKY 609 >ref|XP_006470280.1| PREDICTED: cysteine-rich receptor-like protein kinase 42-like [Citrus sinensis] Length = 664 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/51 (49%), Positives = 35/51 (68%) Frame = +1 Query: 4 SLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVTASSASN 156 +LRP M + + +LT+K C+IP P QPPFLN+SVM+P ++ S S SN Sbjct: 582 ALRPSMAQAIMLLTNKVCEIPTPSQPPFLNSSVMEPGNSSRSCSANSFISN 632 >ref|XP_006446554.1| hypothetical protein CICLE_v10014520mg [Citrus clementina] gi|557549165|gb|ESR59794.1| hypothetical protein CICLE_v10014520mg [Citrus clementina] Length = 664 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/51 (49%), Positives = 35/51 (68%) Frame = +1 Query: 4 SLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVTASSASN 156 +LRP M + + +LT+K C+IP P QPPFLN+SVM+P ++ S S SN Sbjct: 582 ALRPSMAQAIMLLTNKVCEIPTPSQPPFLNSSVMEPGNSSRSCSANSFISN 632 >ref|XP_006841049.1| hypothetical protein AMTR_s00085p00156760 [Amborella trichopoda] gi|548842941|gb|ERN02724.1| hypothetical protein AMTR_s00085p00156760 [Amborella trichopoda] Length = 644 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/53 (52%), Positives = 37/53 (69%) Frame = +1 Query: 4 SLRPYMVEVVQMLTDKDCKIPLPMQPPFLNASVMDPNTTTMSFVTASSASNGP 162 +LRP M VV+MLTD D IPLPMQPPFLN +V++P+ ++ S + S S P Sbjct: 578 NLRPSMSTVVRMLTDDDHPIPLPMQPPFLNTNVINPDASSKSSSSPFSPSPPP 630