BLASTX nr result
ID: Akebia22_contig00016261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00016261 (472 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB71432.1| Constitutive photomorphogenesis protein 10 [Morus... 59 7e-07 ref|XP_002527080.1| ubiquitin-conjugating enzyme E2, putative [R... 59 7e-07 ref|XP_002299458.2| hypothetical protein POPTR_0001s10830g [Popu... 58 2e-06 ref|XP_006445656.1| hypothetical protein CICLE_v10016896mg [Citr... 57 3e-06 >gb|EXB71432.1| Constitutive photomorphogenesis protein 10 [Morus notabilis] Length = 166 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 3 NPLVSGVAHLYLEDRAKHDEIAAAWTMRFAR 95 NPLV G+AHLYL DRAKHDE+AA WT+RFAR Sbjct: 136 NPLVPGIAHLYLADRAKHDELAAEWTLRFAR 166 >ref|XP_002527080.1| ubiquitin-conjugating enzyme E2, putative [Ricinus communis] gi|223533585|gb|EEF35324.1| ubiquitin-conjugating enzyme E2, putative [Ricinus communis] Length = 181 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +3 Query: 3 NPLVSGVAHLYLEDRAKHDEIAAAWTMRFAR 95 NPLV G+AHLYL DRAKHDE+AA WTMRFA+ Sbjct: 151 NPLVPGIAHLYLADRAKHDELAAQWTMRFAK 181 >ref|XP_002299458.2| hypothetical protein POPTR_0001s10830g [Populus trichocarpa] gi|550346982|gb|EEE84263.2| hypothetical protein POPTR_0001s10830g [Populus trichocarpa] Length = 177 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 3 NPLVSGVAHLYLEDRAKHDEIAAAWTMRFAR 95 NPLV G+AHLYL DRAKHDE+AA WT+RFA+ Sbjct: 147 NPLVPGIAHLYLADRAKHDELAAEWTLRFAK 177 >ref|XP_006445656.1| hypothetical protein CICLE_v10016896mg [Citrus clementina] gi|568871449|ref|XP_006488899.1| PREDICTED: constitutive photomorphogenesis protein 10-like [Citrus sinensis] gi|557548267|gb|ESR58896.1| hypothetical protein CICLE_v10016896mg [Citrus clementina] Length = 179 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +3 Query: 3 NPLVSGVAHLYLEDRAKHDEIAAAWTMRFAR 95 NP+V G+AHLYLED+AKHD++AA WT+RFA+ Sbjct: 149 NPIVPGIAHLYLEDKAKHDQLAAEWTLRFAK 179