BLASTX nr result
ID: Akebia22_contig00014412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00014412 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517025.1| pentatricopeptide repeat-containing protein,... 82 1e-13 ref|XP_007034951.1| Tetratricopeptide repeat-like superfamily pr... 80 3e-13 ref|XP_007226853.1| hypothetical protein PRUPE_ppa017194mg, part... 79 5e-13 ref|XP_002280144.2| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 emb|CBI26355.3| unnamed protein product [Vitis vinifera] 73 4e-11 ref|XP_006350660.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_004241033.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_006838870.1| hypothetical protein AMTR_s00002p00266930 [A... 63 4e-08 ref|XP_002274886.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 ref|XP_007158810.1| hypothetical protein PHAVU_002G183800g [Phas... 58 1e-06 ref|XP_002981790.1| hypothetical protein SELMODRAFT_444974 [Sela... 58 1e-06 ref|XP_006585069.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_006580089.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_002967553.1| hypothetical protein SELMODRAFT_88824 [Selag... 57 2e-06 ref|XP_006842084.1| hypothetical protein AMTR_s00078p00067180 [A... 57 3e-06 emb|CBI18084.3| unnamed protein product [Vitis vinifera] 57 3e-06 ref|XP_002265522.1| PREDICTED: putative pentatricopeptide repeat... 57 3e-06 ref|XP_004301492.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_004289150.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 gb|ADE77588.1| unknown [Picea sitchensis] 57 3e-06 >ref|XP_002517025.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543660|gb|EEF45188.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 640 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIY 211 +WDD +KVRAMIRE RV+KNRGSSWIELG V+HEFVMGD K H DSE I+ Sbjct: 576 QWDDFSKVRAMIRENRVRKNRGSSWIELGSVIHEFVMGD-KSHFDSERIF 624 >ref|XP_007034951.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|590658795|ref|XP_007034952.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508713980|gb|EOY05877.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508713981|gb|EOY05878.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 683 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIY 211 RWD VA++RAMIR+ +V+KNR SSWIELGCVVHEFVMGD H+DSE IY Sbjct: 591 RWDGVARMRAMIRKNQVRKNRASSWIELGCVVHEFVMGDAL-HIDSERIY 639 >ref|XP_007226853.1| hypothetical protein PRUPE_ppa017194mg, partial [Prunus persica] gi|462423789|gb|EMJ28052.1| hypothetical protein PRUPE_ppa017194mg, partial [Prunus persica] Length = 584 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/52 (75%), Positives = 43/52 (82%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIYAI 205 +WD VAKVRA+IRE RV+KNRGSSWIELG VHEFVMGD+ H DSE IY I Sbjct: 521 KWDGVAKVRALIREHRVRKNRGSSWIELGSEVHEFVMGDMS-HFDSEWIYLI 571 >ref|XP_002280144.2| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Vitis vinifera] Length = 642 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIYAI 205 RW VAKVRA IRE RV+KNRGSSWIEL VVHEFVMGD+ H DS++I I Sbjct: 575 RWGSVAKVRAKIREHRVRKNRGSSWIELSHVVHEFVMGDMS-HTDSDSISLI 625 >emb|CBI26355.3| unnamed protein product [Vitis vinifera] Length = 550 Score = 73.2 bits (178), Expect = 4e-11 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIYAI 205 RW VAKVRA IRE RV+KNRGSSWIEL VVHEFVMGD+ H DS++I I Sbjct: 483 RWGSVAKVRAKIREHRVRKNRGSSWIELSHVVHEFVMGDMS-HTDSDSISLI 533 >ref|XP_006350660.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum tuberosum] Length = 668 Score = 72.4 bits (176), Expect = 6e-11 Identities = 35/49 (71%), Positives = 39/49 (79%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENI 214 RW DVA+VRA+IRE VKKNRGSSWIEL VHEFVMGDV H+D + I Sbjct: 575 RWHDVARVRALIREHHVKKNRGSSWIELDSAVHEFVMGDVS-HVDVDRI 622 >ref|XP_004241033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum lycopersicum] Length = 668 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENI 214 RW DVA+VRA+IRE VKKNRGSSWIEL VHEFVMGDV H++ + I Sbjct: 575 RWHDVARVRALIREHHVKKNRGSSWIELDSAVHEFVMGDVS-HVEVDRI 622 >ref|XP_006838870.1| hypothetical protein AMTR_s00002p00266930 [Amborella trichopoda] gi|548841376|gb|ERN01439.1| hypothetical protein AMTR_s00002p00266930 [Amborella trichopoda] Length = 646 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIYAI 205 +W++V+K+RAM RER V+KNRG SWIE+ VHEF+M D + H DS +IY + Sbjct: 577 QWENVSKLRAMRRERGVRKNRGCSWIEVNSCVHEFIMED-RRHPDSNSIYEV 627 >ref|XP_002274886.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18750, chloroplastic-like [Vitis vinifera] Length = 736 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = -3 Query: 363 ERWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIYA 208 +RWDDV +VRAM+R + +KK+ G S+IEL +VH F++GD K H +E+IYA Sbjct: 581 KRWDDVERVRAMVRRKGLKKSPGCSFIELDNMVHRFLVGD-KSHQQTEDIYA 631 >ref|XP_007158810.1| hypothetical protein PHAVU_002G183800g [Phaseolus vulgaris] gi|561032225|gb|ESW30804.1| hypothetical protein PHAVU_002G183800g [Phaseolus vulgaris] Length = 573 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/50 (60%), Positives = 36/50 (72%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIY 211 RWDDVA++R MI++RRVKK G SWIE+ VH FV GD K H S+ IY Sbjct: 417 RWDDVAELRKMIKDRRVKKKVGRSWIEVQGEVHVFVAGDWK-HERSKEIY 465 >ref|XP_002981790.1| hypothetical protein SELMODRAFT_444974 [Selaginella moellendorffii] gi|300150622|gb|EFJ17272.1| hypothetical protein SELMODRAFT_444974 [Selaginella moellendorffii] Length = 611 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIY 211 RW DV K+R ++ R VKK+ G SWIE+G VVHEFV GD + H E IY Sbjct: 457 RWKDVEKIRKIMAARGVKKSPGKSWIEIGDVVHEFVSGD-RSHPQGEEIY 505 >ref|XP_006585069.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like isoform X1 [Glycine max] gi|571470623|ref|XP_006585070.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like isoform X2 [Glycine max] gi|571470625|ref|XP_006585071.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like isoform X3 [Glycine max] Length = 574 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIY 211 RWDDVA++R M+++RRVKK G SWIE+ VH FV GD K H S+ IY Sbjct: 418 RWDDVAELRKMMKDRRVKKKGGRSWIEVQGEVHVFVAGDWK-HERSKEIY 466 >ref|XP_006580089.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like isoform X1 [Glycine max] gi|571455429|ref|XP_006580090.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like isoform X2 [Glycine max] Length = 574 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIY 211 RWDDVA++R M+++RRVKK G SWIE+ VH FV GD K H S+ IY Sbjct: 418 RWDDVAELRKMMKDRRVKKKGGRSWIEVQGEVHVFVAGDWK-HERSKEIY 466 >ref|XP_002967553.1| hypothetical protein SELMODRAFT_88824 [Selaginella moellendorffii] gi|300164291|gb|EFJ30900.1| hypothetical protein SELMODRAFT_88824 [Selaginella moellendorffii] Length = 670 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/50 (56%), Positives = 33/50 (66%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIY 211 RW DV K+R ++ R VKK+ G SWIE+G VVHEFV GD H E IY Sbjct: 516 RWKDVEKIRKIMAARGVKKSPGKSWIEIGDVVHEFVSGD-SSHPQGEEIY 564 >ref|XP_006842084.1| hypothetical protein AMTR_s00078p00067180 [Amborella trichopoda] gi|548844133|gb|ERN03759.1| hypothetical protein AMTR_s00078p00067180 [Amborella trichopoda] Length = 495 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/53 (54%), Positives = 34/53 (64%) Frame = -3 Query: 363 ERWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIYAI 205 E W DVAKVR M+RER KK G SW+E+G +H FV D K H + IYAI Sbjct: 417 ESWSDVAKVRKMLRERCEKKVPGCSWMEIGSKIHSFVSSD-KSHPQVKEIYAI 468 >emb|CBI18084.3| unnamed protein product [Vitis vinifera] Length = 496 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/51 (52%), Positives = 37/51 (72%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIYA 208 +WD+ AKVR + E+R++K G SWIE+ +VHEF++GD K H SE IYA Sbjct: 342 KWDEAAKVRLSMNEKRIQKPPGCSWIEVDGIVHEFLVGD-KYHPLSEKIYA 391 >ref|XP_002265522.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g08820-like [Vitis vinifera] Length = 686 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/51 (52%), Positives = 37/51 (72%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIYA 208 +WD+ AKVR + E+R++K G SWIE+ +VHEF++GD K H SE IYA Sbjct: 532 KWDEAAKVRLSMNEKRIQKPPGCSWIEVDGIVHEFLVGD-KYHPLSEKIYA 581 >ref|XP_004301492.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like, partial [Fragaria vesca subsp. vesca] Length = 800 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/50 (52%), Positives = 36/50 (72%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIY 211 RWDDVAKVR ++RER VKK G SWI++ +VH F++GD + H + +Y Sbjct: 646 RWDDVAKVRNLMRERGVKKEPGCSWIDVDNMVHVFLVGDTR-HPEVNEVY 694 >ref|XP_004289150.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Fragaria vesca subsp. vesca] Length = 710 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/52 (50%), Positives = 40/52 (76%) Frame = -3 Query: 363 ERWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIYA 208 +RWDDV +VRAM+R++ +KK G +++EL +VH F++GD K H +E+IYA Sbjct: 555 KRWDDVERVRAMVRKKGLKKPPGCTFVELDKMVHRFLVGD-KSHPQTEDIYA 605 >gb|ADE77588.1| unknown [Picea sitchensis] Length = 312 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = -3 Query: 360 RWDDVAKVRAMIRERRVKKNRGSSWIELGCVVHEFVMGDVKPHLDSENIYAI 205 RWDDVAKVR M++E+ VKK+ G S IE+ +H FV+GD+ H +E IYA+ Sbjct: 158 RWDDVAKVRKMMKEKDVKKSPGCSLIEVNNKLHSFVVGDIS-HPQTEAIYAM 208