BLASTX nr result
ID: Akebia22_contig00014179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00014179 (1204 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS50104.1| Retrovirus-related Pol polyprotein LINE-1 [Tritic... 52 2e-07 gb|EMS52533.1| ATP-citrate synthase [Triticum urartu] 48 6e-06 gb|EMS49379.1| Retrovirus-related Pol polyprotein LINE-1 [Tritic... 48 9e-06 gb|EMS59319.1| V-type proton ATPase subunit B 2 [Triticum urartu] 49 1e-05 ref|XP_003581610.1| PREDICTED: uncharacterized protein LOC100840... 47 1e-05 >gb|EMS50104.1| Retrovirus-related Pol polyprotein LINE-1 [Triticum urartu] Length = 3154 Score = 52.4 bits (124), Expect(2) = 2e-07 Identities = 29/62 (46%), Positives = 39/62 (62%) Frame = -3 Query: 743 LHQGSTLRPRLFVLVVDGVTSHIQGQYPLCILLSDVTVLLEWGESEKNEGIRQNVVINIR 564 LHQGS L P LF LV+D VT IQG P C+L +D VL++ + + GI ++V N R Sbjct: 2257 LHQGSALSPYLFALVMDEVTRDIQGDIPWCMLFADDVVLVDDSRTGADGGIDEDV--NHR 2314 Query: 563 VK 558 +K Sbjct: 2315 IK 2316 Score = 30.8 bits (68), Expect(2) = 2e-07 Identities = 14/43 (32%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -2 Query: 906 KKRKNFHIVFVD*--AYEKKC**LIWWVLGKK*LSRRYINRVR 784 +++K+ H+VF+D AY+K ++WW L K + +YI ++ Sbjct: 2189 EQKKDLHMVFIDLEKAYDKMPRNVMWWALEKHKVPAKYITLIK 2231 >gb|EMS52533.1| ATP-citrate synthase [Triticum urartu] Length = 589 Score = 48.1 bits (113), Expect(2) = 6e-06 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = -3 Query: 743 LHQGSTLRPRLFVLVVDGVTSHIQGQYPLCILLSDVTVLLE 621 LHQGS L P LF LV+D VT IQG P C+L +D VL++ Sbjct: 472 LHQGSALSPYLFALVMDEVTRDIQGDIPWCMLFADDVVLVD 512 Score = 30.0 bits (66), Expect(2) = 6e-06 Identities = 14/43 (32%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -2 Query: 906 KKRKNFHIVFVD*--AYEKKC**LIWWVLGKK*LSRRYINRVR 784 +++K+ H+VF+D AY+K ++WW L K + +YI ++ Sbjct: 404 EQKKDLHMVFIDLEKAYDKIPRNVMWWALEKHKVPAKYITLIK 446 >gb|EMS49379.1| Retrovirus-related Pol polyprotein LINE-1 [Triticum urartu] Length = 882 Score = 48.1 bits (113), Expect(2) = 9e-06 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = -3 Query: 743 LHQGSTLRPRLFVLVVDGVTSHIQGQYPLCILLSDVTVLLE 621 LHQGS L P LF LV+D VT IQG P C+L +D VL++ Sbjct: 229 LHQGSALSPYLFALVMDEVTRDIQGDIPWCMLFADDVVLVD 269 Score = 29.3 bits (64), Expect(2) = 9e-06 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = -2 Query: 903 KRKNFHIVFVD*--AYEKKC**LIWWVLGKK*LSRRYINRVR 784 + K+ H+VF+D AY+K ++WW L K + +YI ++ Sbjct: 162 RNKDLHMVFIDLEKAYDKIPRNVMWWALEKHKVPAKYITLIK 203 >gb|EMS59319.1| V-type proton ATPase subunit B 2 [Triticum urartu] Length = 605 Score = 48.5 bits (114), Expect(2) = 1e-05 Identities = 25/50 (50%), Positives = 31/50 (62%) Frame = -3 Query: 743 LHQGSTLRPRLFVLVVDGVTSHIQGQYPLCILLSDVTVLLEWGESEKNEG 594 LHQGS L P LF LV+D VT IQG P C+L +D VL++ + EG Sbjct: 184 LHQGSALSPYLFALVMDEVTRDIQGDIPWCMLFADDVVLVDDSRTGVFEG 233 Score = 28.9 bits (63), Expect(2) = 1e-05 Identities = 13/43 (30%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = -2 Query: 906 KKRKNFHIVFVD*--AYEKKC**LIWWVLGKK*LSRRYINRVR 784 +++K+ H+VF+D +Y+K ++WW L K + +YI ++ Sbjct: 116 EQKKDLHMVFIDLEKSYDKIPRNVMWWALKKHKVPAKYITLIK 158 >ref|XP_003581610.1| PREDICTED: uncharacterized protein LOC100840703 [Brachypodium distachyon] Length = 567 Score = 47.0 bits (110), Expect(2) = 1e-05 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = -3 Query: 743 LHQGSTLRPRLFVLVVDGVTSHIQGQYPLCILLSDVTVLLE 621 LHQGS L P LF LV+D VT IQG P C+L +D VL++ Sbjct: 279 LHQGSALSPYLFDLVMDEVTRDIQGDIPWCMLFADDVVLVD 319 Score = 30.4 bits (67), Expect(2) = 1e-05 Identities = 14/44 (31%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = -2 Query: 909 EKKRKNFHIVFVD*--AYEKKC**LIWWVLGKK*LSRRYINRVR 784 ++++K+ H+VF+D AY+K ++WW L K + +YI ++ Sbjct: 210 KEQKKDLHMVFIDLEKAYDKIPRNVMWWALEKHKVPAKYITLIK 253