BLASTX nr result
ID: Akebia22_contig00012983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00012983 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275038.1| PREDICTED: chaperone protein ClpB1-like [Vit... 76 6e-12 emb|CAN83664.1| hypothetical protein VITISV_031478 [Vitis vinifera] 76 6e-12 ref|XP_007027938.1| Double Clp-N motif-containing P-loop nucleos... 66 6e-09 ref|XP_006481582.1| PREDICTED: uncharacterized protein LOC102621... 62 6e-08 ref|XP_006430083.1| hypothetical protein CICLE_v10011051mg [Citr... 62 6e-08 ref|XP_006588864.1| PREDICTED: uncharacterized protein LOC100813... 57 3e-06 ref|XP_002532538.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002275038.1| PREDICTED: chaperone protein ClpB1-like [Vitis vinifera] Length = 848 Score = 75.9 bits (185), Expect = 6e-12 Identities = 32/55 (58%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -3 Query: 226 YDQHYPNLHQTHQTWPITVQPKQQWGDRHFWIADTVEEE-EPVLRMYIPDHREPK 65 YDQ YPNLHQTHQ WP+ V+ KQ W D HFW+++ + + EP LRMYIP+H + K Sbjct: 516 YDQQYPNLHQTHQGWPV-VEHKQSWRDNHFWVSEALNKTYEPSLRMYIPEHSDRK 569 >emb|CAN83664.1| hypothetical protein VITISV_031478 [Vitis vinifera] Length = 828 Score = 75.9 bits (185), Expect = 6e-12 Identities = 32/55 (58%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -3 Query: 226 YDQHYPNLHQTHQTWPITVQPKQQWGDRHFWIADTVEEE-EPVLRMYIPDHREPK 65 YDQ YPNLHQTHQ WP+ V+ KQ W D HFW+++ + + EP LRMYIP+H + K Sbjct: 496 YDQQYPNLHQTHQGWPV-VEHKQSWRDNHFWVSEALNKTYEPSLRMYIPEHSDRK 549 >ref|XP_007027938.1| Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein [Theobroma cacao] gi|508716543|gb|EOY08440.1| Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein [Theobroma cacao] Length = 857 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/56 (48%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = -3 Query: 226 YDQHYPNLHQTHQTWPITVQPKQQWGDRHFWIADTVEE--EEPVLRMYIPDHREPK 65 +DQ Y +LH H WP+ V+P+Q W D FWI++TV++ E LR+YIP+H++PK Sbjct: 523 HDQQYSHLHPPHHDWPV-VEPRQSWKDHQFWISETVDKIVEPTGLRLYIPEHKDPK 577 >ref|XP_006481582.1| PREDICTED: uncharacterized protein LOC102621295 [Citrus sinensis] Length = 854 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = -3 Query: 226 YDQHYPNLHQTHQTWPITVQPKQQWGDRHFWIADTVEEE---EPVLRMYIPDHREPK 65 YDQ YPN H+TH+ W + V+PKQ W + HF + ++ EP LR+YIP+H++ K Sbjct: 518 YDQQYPNFHKTHRDWAV-VEPKQSWREHHFLFSHEASDKSTSEPSLRLYIPEHKDLK 573 >ref|XP_006430083.1| hypothetical protein CICLE_v10011051mg [Citrus clementina] gi|557532140|gb|ESR43323.1| hypothetical protein CICLE_v10011051mg [Citrus clementina] Length = 854 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Frame = -3 Query: 226 YDQHYPNLHQTHQTWPITVQPKQQWGDRHFWIADTVEEE---EPVLRMYIPDHREPK 65 YDQ YPN H+TH+ W + V+PKQ W + HF + ++ EP LR+YIP+H++ K Sbjct: 518 YDQQYPNFHKTHRDWAV-VEPKQSWREHHFLFSHEASDKSTCEPSLRLYIPEHKDLK 573 >ref|XP_006588864.1| PREDICTED: uncharacterized protein LOC100813578 [Glycine max] Length = 869 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 2/54 (3%) Frame = -3 Query: 226 YDQHYPNLHQTHQTWPITVQPKQQWGDRHFWIAD--TVEEEEPVLRMYIPDHRE 71 Y Q +PNLHQTH W + PK + HFWI++ + EP LR+YIP++ + Sbjct: 527 YGQQHPNLHQTHNEWQVAEPPKDSLNNHHFWISNNGSNNTNEPTLRVYIPENNK 580 >ref|XP_002532538.1| conserved hypothetical protein [Ricinus communis] gi|223527727|gb|EEF29832.1| conserved hypothetical protein [Ricinus communis] Length = 882 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/59 (47%), Positives = 37/59 (62%), Gaps = 9/59 (15%) Frame = -3 Query: 226 YDQHYPNLHQTH--QTWPITVQPKQQWGDRHFWI-ADTVEE------EEPVLRMYIPDH 77 YD YPN H T+ + WP+ V+ KQ W D HFW+ ++TV + EP LRMYIP+H Sbjct: 520 YDHQYPNFHHTYHQRDWPV-VESKQSWRDHHFWVGSETVNKINSCISIEPSLRMYIPEH 577