BLASTX nr result
ID: Akebia22_contig00012959
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00012959 (646 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533493.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 >ref|XP_002533493.1| conserved hypothetical protein [Ricinus communis] gi|223526655|gb|EEF28897.1| conserved hypothetical protein [Ricinus communis] Length = 139 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/88 (34%), Positives = 48/88 (54%) Frame = -2 Query: 477 EEVIFGVCFMTVMSIIQLPYEIIDGNPIPTVIFNDHPSTXXXXXXXXXXXXXXAVCGIWL 298 +EVIF V +T ++I+ LP E I P+P+VIF+ HPS +VC I L Sbjct: 47 DEVIFTVSCLTTIAILYLPMEYIAEKPVPSVIFHGHPSMFHAFLICLMGSCFGSVCSIHL 106 Query: 297 YDPLPKSRRFFRFSAVMFMTAAIGIFVW 214 + PK +F+ F V+ M ++ +F++ Sbjct: 107 RERSPKVGKFYHFFGVLSMVFSLAVFLF 134