BLASTX nr result
ID: Akebia22_contig00010823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00010823 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75635.1| hypothetical protein VITISV_044171 [Vitis vinifera] 59 7e-07 >emb|CAN75635.1| hypothetical protein VITISV_044171 [Vitis vinifera] Length = 141 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +3 Query: 3 YVGAFIILCARIDYREKPGLIACTIAVSIPHPLFHWNFIMEI 128 YVG F++LCAR+DYREKPG IACTIAVS + F +NF+ ++ Sbjct: 100 YVGFFLLLCARVDYREKPGYIACTIAVSKLYCSFDFNFMEDV 141