BLASTX nr result
ID: Akebia22_contig00009991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00009991 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002441306.1| hypothetical protein SORBIDRAFT_09g024150 [S... 56 4e-06 >ref|XP_002441306.1| hypothetical protein SORBIDRAFT_09g024150 [Sorghum bicolor] gi|241946591|gb|EES19736.1| hypothetical protein SORBIDRAFT_09g024150 [Sorghum bicolor] Length = 463 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/36 (77%), Positives = 30/36 (83%), Gaps = 1/36 (2%) Frame = -3 Query: 251 DCNRCLVNAVAQTQSCCDGKQGGRVI-QSSSIRFWV 147 DCNRCLVNAVA +CCDGKQGGRVI +S SIRF V Sbjct: 202 DCNRCLVNAVAFIPNCCDGKQGGRVIGRSCSIRFEV 237