BLASTX nr result
ID: Akebia22_contig00009845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00009845 (265 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006480080.1| PREDICTED: probable LRR receptor-like serine... 60 3e-07 ref|XP_006480078.1| PREDICTED: probable LRR receptor-like serine... 60 3e-07 ref|XP_006479462.1| PREDICTED: probable LRR receptor-like serine... 60 3e-07 ref|XP_006443768.1| hypothetical protein CICLE_v10024331mg [Citr... 60 3e-07 ref|XP_006443766.1| hypothetical protein CICLE_v10024479mg, part... 60 3e-07 ref|XP_006371548.1| hypothetical protein POPTR_0019s13060g [Popu... 57 4e-06 ref|XP_007140129.1| hypothetical protein PHAVU_008G086400g [Phas... 56 5e-06 gb|EMT33736.1| Putative LRR receptor-like serine/threonine-prote... 56 6e-06 gb|EMT14955.1| Putative LRR receptor-like serine/threonine-prote... 56 6e-06 dbj|BAJ98730.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 6e-06 ref|XP_002439362.1| hypothetical protein SORBIDRAFT_09g005150 [S... 56 6e-06 ref|XP_004170237.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR... 55 8e-06 ref|XP_004138272.1| PREDICTED: probable LRR receptor-like serine... 55 8e-06 >ref|XP_006480080.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Citrus sinensis] Length = 1126 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = +2 Query: 134 SGKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKLS 265 S KIPAEIG LS L YLDLS NNL G IP KL C+ L+FLKLS Sbjct: 690 SDKIPAEIGKLSRLQYLDLSENNLDGPIPDKLGDCEALIFLKLS 733 >ref|XP_006480078.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Citrus sinensis] Length = 507 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = +2 Query: 134 SGKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKLS 265 S KIPAEIG LS L YLDLS NNL G IP KL C+ L+FLKLS Sbjct: 71 SDKIPAEIGKLSRLQYLDLSENNLDGPIPDKLGDCETLIFLKLS 114 >ref|XP_006479462.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Citrus sinensis] Length = 1017 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = +2 Query: 134 SGKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKLS 265 S KIPAEIG LS L YLDLS NNL G IP KL C+ L+FLKLS Sbjct: 581 SDKIPAEIGKLSRLQYLDLSENNLDGPIPDKLGDCEALIFLKLS 624 >ref|XP_006443768.1| hypothetical protein CICLE_v10024331mg [Citrus clementina] gi|557546030|gb|ESR57008.1| hypothetical protein CICLE_v10024331mg [Citrus clementina] Length = 1167 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = +2 Query: 134 SGKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKLS 265 S KIPAEIG LS L YLDLS NNL G IP KL C+ L+FLKLS Sbjct: 653 SDKIPAEIGKLSRLQYLDLSENNLDGPIPDKLGDCEALIFLKLS 696 >ref|XP_006443766.1| hypothetical protein CICLE_v10024479mg, partial [Citrus clementina] gi|557546028|gb|ESR57006.1| hypothetical protein CICLE_v10024479mg, partial [Citrus clementina] Length = 1270 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = +2 Query: 134 SGKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKLS 265 S KIPAEIG LS L YLDLS NNL G IP KL C+ L+FLKLS Sbjct: 677 SDKIPAEIGKLSRLQYLDLSENNLDGPIPDKLGDCETLIFLKLS 720 >ref|XP_006371548.1| hypothetical protein POPTR_0019s13060g [Populus trichocarpa] gi|550317427|gb|ERP49345.1| hypothetical protein POPTR_0019s13060g [Populus trichocarpa] Length = 897 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 134 SGKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKLS 265 SGKIP EIG+L L YLDL+ANNL+G IP +L C ++L+L LS Sbjct: 360 SGKIPPEIGSLPDLSYLDLAANNLSGTIPKQLGKCSKMLYLNLS 403 >ref|XP_007140129.1| hypothetical protein PHAVU_008G086400g [Phaseolus vulgaris] gi|561013262|gb|ESW12123.1| hypothetical protein PHAVU_008G086400g [Phaseolus vulgaris] Length = 1090 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 134 SGKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKL 262 +GKIP EIGNL L +LD+S+NNL G+IP L+GC+ L FL L Sbjct: 476 AGKIPPEIGNLKSLNFLDMSSNNLAGEIPPTLSGCQNLEFLDL 518 >gb|EMT33736.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops tauschii] Length = 1178 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +2 Query: 137 GKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKLS 265 G++P EIG+L++L YLDLS+NNLTG++P + C +L FLKLS Sbjct: 564 GEVPQEIGSLNNLEYLDLSSNNLTGQLPRSIGNCLKLHFLKLS 606 >gb|EMT14955.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops tauschii] Length = 755 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = +2 Query: 134 SGKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKL 262 +G IPA+IG L HL +LDLS+N L+G IPA++ GC+ L F+ L Sbjct: 333 AGAIPAQIGKLGHLSFLDLSSNRLSGAIPAEIAGCRNLTFVDL 375 >dbj|BAJ98730.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 1118 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = +2 Query: 134 SGKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKL 262 +G IPA+IG L HL +LDLS+N L+G IPA++ GC+ L F+ L Sbjct: 477 AGAIPAQIGKLGHLSFLDLSSNRLSGAIPAEIAGCRNLTFVDL 519 >ref|XP_002439362.1| hypothetical protein SORBIDRAFT_09g005150 [Sorghum bicolor] gi|241944647|gb|EES17792.1| hypothetical protein SORBIDRAFT_09g005150 [Sorghum bicolor] Length = 978 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 134 SGKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKL 262 +G IPAE+GNL+ L LDLS NNL+G IPA+L+ C EL LKL Sbjct: 619 TGAIPAELGNLTRLSMLDLSLNNLSGDIPAELSSCVELTHLKL 661 >ref|XP_004170237.1| PREDICTED: LOW QUALITY PROTEIN: probable LRR receptor-like serine/threonine-protein kinase At4g26540-like [Cucumis sativus] Length = 1131 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = +2 Query: 134 SGKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKL 262 SG+IP EIGNL LI+LDL N+LTG +P +++GC+ L FL + Sbjct: 473 SGEIPPEIGNLKSLIFLDLGNNHLTGALPPEISGCRNLTFLDM 515 >ref|XP_004138272.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g26540-like [Cucumis sativus] Length = 1132 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = +2 Query: 134 SGKIPAEIGNLSHLIYLDLSANNLTGKIPAKLTGCKELLFLKL 262 SG+IP EIGNL LI+LDL N+LTG +P +++GC+ L FL + Sbjct: 474 SGEIPPEIGNLKSLIFLDLGNNHLTGALPPEISGCRNLTFLDM 516