BLASTX nr result
ID: Akebia22_contig00008469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00008469 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516862.1| hypothetical protein GlmaxMp13 (mitochondrio... 71 1e-10 >ref|YP_007516862.1| hypothetical protein GlmaxMp13 (mitochondrion) [Glycine max] gi|403311591|gb|AFR34339.1| hypothetical protein GlmaxMp13 (mitochondrion) [Glycine max] Length = 287 Score = 71.2 bits (173), Expect = 1e-10 Identities = 43/74 (58%), Positives = 50/74 (67%), Gaps = 5/74 (6%) Frame = +1 Query: 52 AGVLGRWGFLFLNKFVTVS----LTCLV*HFVMSWLNG*-DLSSSGTGPSIDHGAYSTLT 216 AGVLGRWGFLFLN+F VS + + W+ G D SSSGTGPSIDHGAYSTLT Sbjct: 60 AGVLGRWGFLFLNQFGCVSPEIGWSNIYELAGQRWMEGKIDWSSSGTGPSIDHGAYSTLT 119 Query: 217 EFILFY*SGELLSI 258 EFIL + +LL + Sbjct: 120 EFILLKRNVKLLML 133