BLASTX nr result
ID: Akebia22_contig00007339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00007339 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK46972.1| unknown [Lotus japonicus] 69 7e-10 ref|XP_006338279.1| PREDICTED: cyclin-B1-2-like [Solanum tuberosum] 69 9e-10 ref|XP_004233649.1| PREDICTED: cyclin-B1-2-like [Solanum lycoper... 69 9e-10 gb|AAC32158.1| hypothetical protein [Picea mariana] 68 2e-09 ref|XP_004511459.1| PREDICTED: cyclin-B1-2-like [Cicer arietinum] 67 2e-09 ref|XP_004156232.1| PREDICTED: proteasome maturation protein hom... 67 2e-09 ref|XP_004141496.1| PREDICTED: cyclin-B1-2-like [Cucumis sativus] 67 2e-09 gb|AAF02452.1|AF127435_1 unknown [Picea abies] gi|6049100|gb|AAF... 67 3e-09 gb|AAC32157.1| hypothetical protein [Picea mariana] gi|2996134|g... 67 3e-09 gb|AAC32110.1| hypothetical protein [Picea mariana] 67 3e-09 gb|ABK21214.1| unknown [Picea sitchensis] 67 3e-09 ref|XP_002283197.1| PREDICTED: cyclin-B1-2 [Vitis vinifera] gi|2... 66 4e-09 ref|XP_006590266.1| PREDICTED: uncharacterized protein LOC100500... 66 6e-09 ref|XP_006842692.1| hypothetical protein AMTR_s00147p00071690 [A... 66 6e-09 ref|XP_003540206.1| PREDICTED: cyclin-B1-2-like [Glycine max] 66 6e-09 gb|EYU39374.1| hypothetical protein MIMGU_mgv1a015968mg [Mimulus... 65 1e-08 ref|XP_006430820.1| hypothetical protein CICLE_v10013059mg [Citr... 65 1e-08 ref|XP_006482298.1| PREDICTED: cyclin-B1-2-like [Citrus sinensis] 65 1e-08 ref|XP_006841795.1| hypothetical protein AMTR_s00003p00267670 [A... 65 1e-08 emb|CAN69726.1| hypothetical protein VITISV_009153 [Vitis vinifera] 65 1e-08 >gb|AFK46972.1| unknown [Lotus japonicus] Length = 142 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESET RP DMHHGMEVRLGLSKGPVCPSF+ Sbjct: 110 DPRESETIRPLDMHHGMEVRLGLSKGPVCPSFM 142 >ref|XP_006338279.1| PREDICTED: cyclin-B1-2-like [Solanum tuberosum] Length = 141 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DP+ESE+FRP DMHHG+EVRLGLSKGPVCPSFI Sbjct: 109 DPKESESFRPVDMHHGVEVRLGLSKGPVCPSFI 141 >ref|XP_004233649.1| PREDICTED: cyclin-B1-2-like [Solanum lycopersicum] Length = 198 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DP+ESE+FRP DMHHG+EVRLGLSKGPVCPSFI Sbjct: 166 DPKESESFRPVDMHHGVEVRLGLSKGPVCPSFI 198 >gb|AAC32158.1| hypothetical protein [Picea mariana] Length = 46 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/33 (93%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESETF PADMHHGMEVRLGLSKGPVC SFI Sbjct: 14 DPRESETFVPADMHHGMEVRLGLSKGPVCRSFI 46 >ref|XP_004511459.1| PREDICTED: cyclin-B1-2-like [Cicer arietinum] Length = 142 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESET RP DMH+GMEVRLGLSKGPVCPSFI Sbjct: 110 DPRESETLRPLDMHNGMEVRLGLSKGPVCPSFI 142 >ref|XP_004156232.1| PREDICTED: proteasome maturation protein homolog [Cucumis sativus] Length = 93 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESE+ RP DMHHGMEVRLGLSKGPVCPSF+ Sbjct: 61 DPRESESLRPLDMHHGMEVRLGLSKGPVCPSFM 93 >ref|XP_004141496.1| PREDICTED: cyclin-B1-2-like [Cucumis sativus] Length = 141 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESE+ RP DMHHGMEVRLGLSKGPVCPSF+ Sbjct: 109 DPRESESLRPLDMHHGMEVRLGLSKGPVCPSFM 141 >gb|AAF02452.1|AF127435_1 unknown [Picea abies] gi|6049100|gb|AAF02453.1|AF127436_1 unknown [Picea abies] Length = 48 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESETF PADMHHGMEVRLGLSKGPVC SF+ Sbjct: 16 DPRESETFVPADMHHGMEVRLGLSKGPVCRSFM 48 >gb|AAC32157.1| hypothetical protein [Picea mariana] gi|2996134|gb|AAC32159.1| hypothetical protein [Picea mariana] Length = 46 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESETF PADMHHGMEVRLGLSKGPVC SF+ Sbjct: 14 DPRESETFVPADMHHGMEVRLGLSKGPVCRSFM 46 >gb|AAC32110.1| hypothetical protein [Picea mariana] Length = 141 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESETF PADMHHGMEVRLGLSKGPVC SF+ Sbjct: 109 DPRESETFVPADMHHGMEVRLGLSKGPVCRSFM 141 >gb|ABK21214.1| unknown [Picea sitchensis] Length = 141 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESETF PADMHHGMEVRLGLSKGPVC SF+ Sbjct: 109 DPRESETFVPADMHHGMEVRLGLSKGPVCRSFM 141 >ref|XP_002283197.1| PREDICTED: cyclin-B1-2 [Vitis vinifera] gi|298204380|emb|CBI16860.3| unnamed protein product [Vitis vinifera] Length = 141 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DP +SETFRPADMHHGMEVR G+SKGP+CPSFI Sbjct: 109 DPCDSETFRPADMHHGMEVRHGISKGPICPSFI 141 >ref|XP_006590266.1| PREDICTED: uncharacterized protein LOC100500555 isoform X1 [Glycine max] Length = 144 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESETFRP DMHHGMEVRLGLSKGPV PS I Sbjct: 112 DPRESETFRPLDMHHGMEVRLGLSKGPVYPSII 144 >ref|XP_006842692.1| hypothetical protein AMTR_s00147p00071690 [Amborella trichopoda] gi|548844793|gb|ERN04367.1| hypothetical protein AMTR_s00147p00071690 [Amborella trichopoda] Length = 139 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPR+SE+FRP DMH+GMEVRLGL+KGP+CPSFI Sbjct: 107 DPRDSESFRPVDMHNGMEVRLGLAKGPICPSFI 139 >ref|XP_003540206.1| PREDICTED: cyclin-B1-2-like [Glycine max] Length = 144 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESETFRP DMHHGMEVRLGLSKGPV PS I Sbjct: 112 DPRESETFRPLDMHHGMEVRLGLSKGPVYPSII 144 >gb|EYU39374.1| hypothetical protein MIMGU_mgv1a015968mg [Mimulus guttatus] Length = 139 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPR+SE++RP DMHHGMEVRLGLSKGP CPSF+ Sbjct: 107 DPRDSESYRPIDMHHGMEVRLGLSKGPPCPSFM 139 >ref|XP_006430820.1| hypothetical protein CICLE_v10013059mg [Citrus clementina] gi|557532877|gb|ESR44060.1| hypothetical protein CICLE_v10013059mg [Citrus clementina] Length = 141 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESE+FRPAD+HHGMEVR+GLSKGP PSFI Sbjct: 109 DPRESESFRPADLHHGMEVRIGLSKGPAYPSFI 141 >ref|XP_006482298.1| PREDICTED: cyclin-B1-2-like [Citrus sinensis] Length = 141 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPRESE+FRPAD+HHGMEVR+GLSKGP PSFI Sbjct: 109 DPRESESFRPADLHHGMEVRIGLSKGPAHPSFI 141 >ref|XP_006841795.1| hypothetical protein AMTR_s00003p00267670 [Amborella trichopoda] gi|548843816|gb|ERN03470.1| hypothetical protein AMTR_s00003p00267670 [Amborella trichopoda] Length = 88 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DPR+SE+FRP DMH GMEVRLGL KGP+CPSFI Sbjct: 56 DPRDSESFRPVDMHSGMEVRLGLDKGPICPSFI 88 >emb|CAN69726.1| hypothetical protein VITISV_009153 [Vitis vinifera] Length = 141 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -1 Query: 322 DPRESETFRPADMHHGMEVRLGLSKGPVCPSFI 224 DP +SE FRPADMHHGMEVR G+SKGP+CPSFI Sbjct: 109 DPCDSEXFRPADMHHGMEVRXGISKGPICPSFI 141