BLASTX nr result
ID: Akebia22_contig00006574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00006574 (1523 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305553.2| hypothetical protein POPTR_0004s19420g [Popu... 64 1e-07 ref|XP_002525811.1| LysM domain GPI-anchored protein 2 precursor... 64 1e-07 emb|CAN62195.1| hypothetical protein VITISV_025519 [Vitis vinifera] 62 5e-07 gb|EXB95407.1| LysM domain-containing GPI-anchored protein 2 [Mo... 62 7e-07 ref|XP_002278760.2| PREDICTED: lysM domain-containing GPI-anchor... 62 9e-07 emb|CBI37795.3| unnamed protein product [Vitis vinifera] 62 9e-07 ref|XP_004290046.1| PREDICTED: lysM domain-containing GPI-anchor... 60 2e-06 ref|XP_002313676.1| LysM-domain GPI-anchored protein 2 precursor... 60 3e-06 ref|XP_006298034.1| hypothetical protein CARUB_v10014079mg [Caps... 60 3e-06 ref|XP_002278742.1| PREDICTED: lysM domain-containing GPI-anchor... 59 4e-06 ref|XP_006486627.1| PREDICTED: lysM domain-containing GPI-anchor... 59 8e-06 ref|XP_006486626.1| PREDICTED: lysM domain-containing GPI-anchor... 59 8e-06 ref|XP_006422460.1| hypothetical protein CICLE_v10028533mg [Citr... 59 8e-06 >ref|XP_002305553.2| hypothetical protein POPTR_0004s19420g [Populus trichocarpa] gi|550341385|gb|EEE86064.2| hypothetical protein POPTR_0004s19420g [Populus trichocarpa] Length = 352 Score = 64.3 bits (155), Expect = 1e-07 Identities = 29/53 (54%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = -2 Query: 256 MLAGYLCTV----CTPAINSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNWT 110 +LAG + V C ++ S S D PLLVPN TY TANNCV+C CD++NNWT Sbjct: 204 LLAGQVLDVPLQACNSSVTSDSVDYPLLVPNNTYFFTANNCVKCKCDAANNWT 256 >ref|XP_002525811.1| LysM domain GPI-anchored protein 2 precursor, putative [Ricinus communis] gi|223534898|gb|EEF36585.1| LysM domain GPI-anchored protein 2 precursor, putative [Ricinus communis] Length = 361 Score = 64.3 bits (155), Expect = 1e-07 Identities = 28/52 (53%), Positives = 37/52 (71%), Gaps = 4/52 (7%) Frame = -2 Query: 256 MLAGYLCTV----CTPAINSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNW 113 +LAG + V C ++ ++S D PLLVPNGTY TAN+CV+C CDS+NNW Sbjct: 207 LLAGQILDVPLQACNSSVTTSSLDYPLLVPNGTYAFTANSCVRCKCDSANNW 258 >emb|CAN62195.1| hypothetical protein VITISV_025519 [Vitis vinifera] Length = 339 Score = 62.4 bits (150), Expect = 5e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -2 Query: 229 CTPAINSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNWT 110 CT + +TS D PLL+ NGTY TANNCV+C C S+NNWT Sbjct: 205 CTSVVKNTSLDYPLLLSNGTYAYTANNCVKCQCHSANNWT 244 >gb|EXB95407.1| LysM domain-containing GPI-anchored protein 2 [Morus notabilis] Length = 362 Score = 62.0 bits (149), Expect = 7e-07 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -2 Query: 229 CTPAINSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNW 113 C+ ++ + S D+PLLVPNGTY LTA CV+CNC+S+NNW Sbjct: 223 CSSSVRTDSLDSPLLVPNGTYVLTAYRCVKCNCNSANNW 261 >ref|XP_002278760.2| PREDICTED: lysM domain-containing GPI-anchored protein 2 [Vitis vinifera] Length = 353 Score = 61.6 bits (148), Expect = 9e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -2 Query: 229 CTPAINSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNWT 110 CT + +TS D PLL+ NGTY TANNCV+C C S+NNWT Sbjct: 217 CTSVVKNTSLDYPLLLSNGTYAYTANNCVKCQCYSANNWT 256 >emb|CBI37795.3| unnamed protein product [Vitis vinifera] Length = 367 Score = 61.6 bits (148), Expect = 9e-07 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -2 Query: 229 CTPAINSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNWT 110 CT + +TS D PLL+ NGTY TANNCV+C C S+NNWT Sbjct: 208 CTSVVKNTSLDYPLLLSNGTYAYTANNCVKCQCYSANNWT 247 >ref|XP_004290046.1| PREDICTED: lysM domain-containing GPI-anchored protein 2-like [Fragaria vesca subsp. vesca] Length = 353 Score = 60.5 bits (145), Expect = 2e-06 Identities = 27/53 (50%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Frame = -2 Query: 256 MLAGYLCTV----CTPAINSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNWT 110 +LAG + V C ++++ S D+PLLV N TY TANNCV+C C S+NNWT Sbjct: 207 LLAGQVLDVPLKACASSVSNDSFDSPLLVSNNTYVFTANNCVKCQCSSANNWT 259 >ref|XP_002313676.1| LysM-domain GPI-anchored protein 2 precursor [Populus trichocarpa] gi|222850084|gb|EEE87631.1| LysM-domain GPI-anchored protein 2 precursor [Populus trichocarpa] Length = 351 Score = 60.1 bits (144), Expect = 3e-06 Identities = 23/40 (57%), Positives = 29/40 (72%) Frame = -2 Query: 229 CTPAINSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNWT 110 C ++ S D+P LVPN TY TANNCV+C CD++NNWT Sbjct: 217 CNSSVRIDSLDSPFLVPNNTYFFTANNCVKCKCDAANNWT 256 >ref|XP_006298034.1| hypothetical protein CARUB_v10014079mg [Capsella rubella] gi|482566743|gb|EOA30932.1| hypothetical protein CARUB_v10014079mg [Capsella rubella] Length = 351 Score = 59.7 bits (143), Expect = 3e-06 Identities = 27/53 (50%), Positives = 34/53 (64%), Gaps = 4/53 (7%) Frame = -2 Query: 256 MLAGYLCTV----CTPAINSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNWT 110 +LA Y V CT ++ S D PLL+ N +Y TANNCV+C CD+SNNWT Sbjct: 209 LLADYPLNVPLKACTSSVRKDSLDAPLLLSNNSYAFTANNCVKCTCDASNNWT 261 >ref|XP_002278742.1| PREDICTED: lysM domain-containing GPI-anchored protein 2 [Vitis vinifera] gi|297744534|emb|CBI37796.3| unnamed protein product [Vitis vinifera] Length = 357 Score = 59.3 bits (142), Expect = 4e-06 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 1/41 (2%) Frame = -2 Query: 229 CTPAI-NSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNWT 110 CT + N+ S D PLLV NGTY TAN+CV C CDS+NNWT Sbjct: 220 CTSMVANNNSLDYPLLVANGTYVYTANSCVMCKCDSANNWT 260 >ref|XP_006486627.1| PREDICTED: lysM domain-containing GPI-anchored protein 2-like isoform X2 [Citrus sinensis] Length = 358 Score = 58.5 bits (140), Expect = 8e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -2 Query: 229 CTPAINSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNWT 110 C +I + S DN L V NGTYT TAN+CV+C CD++NNWT Sbjct: 221 CNSSIRADSFDNYLRVANGTYTFTANSCVKCQCDATNNWT 260 >ref|XP_006486626.1| PREDICTED: lysM domain-containing GPI-anchored protein 2-like isoform X1 [Citrus sinensis] Length = 368 Score = 58.5 bits (140), Expect = 8e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -2 Query: 229 CTPAINSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNWT 110 C +I + S DN L V NGTYT TAN+CV+C CD++NNWT Sbjct: 221 CNSSIRADSFDNYLRVANGTYTFTANSCVKCQCDATNNWT 260 >ref|XP_006422460.1| hypothetical protein CICLE_v10028533mg [Citrus clementina] gi|557524394|gb|ESR35700.1| hypothetical protein CICLE_v10028533mg [Citrus clementina] Length = 415 Score = 58.5 bits (140), Expect = 8e-06 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -2 Query: 229 CTPAINSTSPDNPLLVPNGTYTLTANNCVQCNCDSSNNWT 110 C +I + S DN L V NGTYT TAN+CV+C CD++NNWT Sbjct: 278 CNSSIKADSFDNYLRVANGTYTFTANSCVKCQCDATNNWT 317