BLASTX nr result
ID: Akebia22_contig00006450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00006450 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285801.1| PREDICTED: endoplasmic reticulum-Golgi inter... 84 3e-14 ref|XP_004150658.1| PREDICTED: endoplasmic reticulum-Golgi inter... 82 8e-14 ref|XP_002513896.1| Endoplasmic reticulum-Golgi intermediate com... 82 1e-13 ref|XP_007227487.1| hypothetical protein PRUPE_ppa007001mg [Prun... 81 1e-13 ref|XP_004514266.1| PREDICTED: endoplasmic reticulum-Golgi inter... 80 2e-13 ref|XP_003544786.1| PREDICTED: endoplasmic reticulum-Golgi inter... 80 2e-13 ref|XP_003542443.1| PREDICTED: endoplasmic reticulum-Golgi inter... 80 4e-13 ref|XP_004975824.1| PREDICTED: endoplasmic reticulum-Golgi inter... 79 5e-13 gb|EYU18489.1| hypothetical protein MIMGU_mgv1a008051mg [Mimulus... 79 7e-13 ref|XP_003615024.1| Endoplasmic reticulum-Golgi intermediate com... 79 7e-13 gb|EXC06716.1| hypothetical protein L484_021555 [Morus notabilis] 79 9e-13 gb|EYU23218.1| hypothetical protein MIMGU_mgv1a007992mg [Mimulus... 78 1e-12 ref|XP_003579883.1| PREDICTED: endoplasmic reticulum-Golgi inter... 78 1e-12 ref|XP_002447951.1| hypothetical protein SORBIDRAFT_06g018670 [S... 78 1e-12 ref|XP_006354000.1| PREDICTED: endoplasmic reticulum-Golgi inter... 77 2e-12 ref|XP_007141162.1| hypothetical protein PHAVU_008G172300g [Phas... 77 2e-12 ref|NP_001031077.1| Endoplasmic reticulum vesicle transporter pr... 77 2e-12 ref|NP_564162.1| Endoplasmic reticulum vesicle transporter prote... 77 2e-12 ref|XP_004237893.1| PREDICTED: endoplasmic reticulum-Golgi inter... 77 3e-12 ref|XP_006416221.1| hypothetical protein EUTSA_v10007894mg [Eutr... 76 6e-12 >ref|XP_002285801.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3 [Vitis vinifera] gi|302141938|emb|CBI19141.3| unnamed protein product [Vitis vinifera] Length = 386 Score = 83.6 bits (205), Expect = 3e-14 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 D +IN+LRNLDAYPKINEDFYSRTLSGGVITLAS+I MLLLFISEL Sbjct: 2 DNIINKLRNLDAYPKINEDFYSRTLSGGVITLASSIFMLLLFISEL 47 >ref|XP_004150658.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Cucumis sativus] gi|449518819|ref|XP_004166433.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Cucumis sativus] Length = 386 Score = 82.0 bits (201), Expect = 8e-14 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 D +I++LRNLDAYPKINEDFYSRTLSGGVITL+S+ILMLLLFISEL Sbjct: 2 DNIISKLRNLDAYPKINEDFYSRTLSGGVITLSSSILMLLLFISEL 47 >ref|XP_002513896.1| Endoplasmic reticulum-Golgi intermediate compartment protein, putative [Ricinus communis] gi|223546982|gb|EEF48479.1| Endoplasmic reticulum-Golgi intermediate compartment protein, putative [Ricinus communis] Length = 386 Score = 81.6 bits (200), Expect = 1e-13 Identities = 40/44 (90%), Positives = 44/44 (100%) Frame = -1 Query: 134 MINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 ++N+LRNLDAYPKINEDFYSRTLSGGVITLAS+ILMLLLFISEL Sbjct: 4 IMNKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFISEL 47 >ref|XP_007227487.1| hypothetical protein PRUPE_ppa007001mg [Prunus persica] gi|462424423|gb|EMJ28686.1| hypothetical protein PRUPE_ppa007001mg [Prunus persica] Length = 386 Score = 81.3 bits (199), Expect = 1e-13 Identities = 39/46 (84%), Positives = 45/46 (97%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 + M++RLRNLDAYPKINEDFYSRTLSGGVITLAS+I+MLLLF+SEL Sbjct: 2 ENMMSRLRNLDAYPKINEDFYSRTLSGGVITLASSIVMLLLFLSEL 47 >ref|XP_004514266.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Cicer arietinum] Length = 386 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 D ++++LRNLDAYPKINEDFYSRTLSGGVITLAS+ILMLLLF SEL Sbjct: 2 DSIMSKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFFSEL 47 >ref|XP_003544786.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Glycine max] Length = 386 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 D ++++LRNLDAYPKINEDFYSRTLSGGVITLAS+ILMLLLF SEL Sbjct: 2 DSIMSKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFFSEL 47 >ref|XP_003542443.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Glycine max] Length = 386 Score = 79.7 bits (195), Expect = 4e-13 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 + +I++LRNLDAYPKINEDFYSRTLSGGVITLAS+ILMLLLF SEL Sbjct: 2 ESIISKLRNLDAYPKINEDFYSRTLSGGVITLASSILMLLLFYSEL 47 >ref|XP_004975824.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Setaria italica] Length = 386 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/46 (76%), Positives = 45/46 (97%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 D ++++LRNLDAYPK+NEDFYSRTLSGG+ITLAS+++MLLLF+SEL Sbjct: 2 DGLLSKLRNLDAYPKVNEDFYSRTLSGGIITLASSVVMLLLFVSEL 47 >gb|EYU18489.1| hypothetical protein MIMGU_mgv1a008051mg [Mimulus guttatus] Length = 386 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISE 6 DKM NRLRNLDAYPKINEDFYSRTLSGGVITL S+I + LLF+SE Sbjct: 2 DKMYNRLRNLDAYPKINEDFYSRTLSGGVITLVSSIFIALLFLSE 46 >ref|XP_003615024.1| Endoplasmic reticulum-Golgi intermediate compartment protein [Medicago truncatula] gi|355516359|gb|AES97982.1| Endoplasmic reticulum-Golgi intermediate compartment protein [Medicago truncatula] Length = 386 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 D ++N+LRNLDAYPKINEDFYSRTLSGG+IT+ S+ILMLLLF SEL Sbjct: 2 DSIMNKLRNLDAYPKINEDFYSRTLSGGLITIVSSILMLLLFFSEL 47 >gb|EXC06716.1| hypothetical protein L484_021555 [Morus notabilis] Length = 386 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/46 (80%), Positives = 45/46 (97%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 + ++++LRNLDAYPKINEDFYSRTLSGGVITLAS+I+MLLLF+SEL Sbjct: 2 ENVMSKLRNLDAYPKINEDFYSRTLSGGVITLASSIVMLLLFLSEL 47 >gb|EYU23218.1| hypothetical protein MIMGU_mgv1a007992mg [Mimulus guttatus] Length = 388 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 + +I +LR+LDAYPKINEDFYSRTLSGGVITLAS+I+MLLLFISEL Sbjct: 4 ESIIGKLRSLDAYPKINEDFYSRTLSGGVITLASSIVMLLLFISEL 49 >ref|XP_003579883.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Brachypodium distachyon] Length = 386 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/46 (78%), Positives = 44/46 (95%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 D ++++LRNLDAYPK+NEDFYSRTLSGGVITLAS+ +MLLLF+SEL Sbjct: 2 DGLMSKLRNLDAYPKVNEDFYSRTLSGGVITLASSFVMLLLFVSEL 47 >ref|XP_002447951.1| hypothetical protein SORBIDRAFT_06g018670 [Sorghum bicolor] gi|241939134|gb|EES12279.1| hypothetical protein SORBIDRAFT_06g018670 [Sorghum bicolor] Length = 386 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/46 (76%), Positives = 45/46 (97%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 D ++++LR+LDAYPK+NEDFYSRTLSGGVITLAS+++MLLLF+SEL Sbjct: 2 DGLLSKLRSLDAYPKVNEDFYSRTLSGGVITLASSVIMLLLFVSEL 47 >ref|XP_006354000.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Solanum tuberosum] Length = 386 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 D I+++R+LDAYPKINEDFYSRTLSGGVITLAS+I+M LLFISEL Sbjct: 2 DSFISKIRSLDAYPKINEDFYSRTLSGGVITLASSIIMTLLFISEL 47 >ref|XP_007141162.1| hypothetical protein PHAVU_008G172300g [Phaseolus vulgaris] gi|561014295|gb|ESW13156.1| hypothetical protein PHAVU_008G172300g [Phaseolus vulgaris] Length = 386 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/44 (84%), Positives = 43/44 (97%) Frame = -1 Query: 134 MINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 ++++LRNLDAYPKINEDFYSRTLSGGVITLAS+I+MLLLF SEL Sbjct: 4 IMSKLRNLDAYPKINEDFYSRTLSGGVITLASSIIMLLLFFSEL 47 >ref|NP_001031077.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis thaliana] gi|332192090|gb|AEE30211.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis thaliana] Length = 338 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 134 MINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 ++NRLRNLDAYPKINEDFY RTLSGGVITLAS+I+ML+LF SEL Sbjct: 4 VMNRLRNLDAYPKINEDFYRRTLSGGVITLASSIVMLILFFSEL 47 >ref|NP_564162.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis thaliana] gi|9454530|gb|AAF87853.1|AC073942_7 Contains similarity to a PR00989 protein from Homo sapiens gi|7959731. EST gb|AI995648 comes from this gene [Arabidopsis thaliana] gi|13878151|gb|AAK44153.1|AF370338_1 unknown protein [Arabidopsis thaliana] gi|21281042|gb|AAM44956.1| unknown protein [Arabidopsis thaliana] gi|21553754|gb|AAM62847.1| unknown [Arabidopsis thaliana] gi|332192089|gb|AEE30210.1| Endoplasmic reticulum vesicle transporter protein [Arabidopsis thaliana] Length = 386 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -1 Query: 134 MINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 ++NRLRNLDAYPKINEDFY RTLSGGVITLAS+I+ML+LF SEL Sbjct: 4 VMNRLRNLDAYPKINEDFYRRTLSGGVITLASSIVMLILFFSEL 47 >ref|XP_004237893.1| PREDICTED: endoplasmic reticulum-Golgi intermediate compartment protein 3-like [Solanum lycopersicum] Length = 386 Score = 77.0 bits (188), Expect = 3e-12 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -1 Query: 140 DKMINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 D ++++R+LDAYPKINEDFYSRTLSGGVITLAS+I+M LLFISEL Sbjct: 2 DSFVSKIRSLDAYPKINEDFYSRTLSGGVITLASSIIMTLLFISEL 47 >ref|XP_006416221.1| hypothetical protein EUTSA_v10007894mg [Eutrema salsugineum] gi|557093992|gb|ESQ34574.1| hypothetical protein EUTSA_v10007894mg [Eutrema salsugineum] Length = 386 Score = 75.9 bits (185), Expect = 6e-12 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -1 Query: 134 MINRLRNLDAYPKINEDFYSRTLSGGVITLASTILMLLLFISEL 3 ++NRLRNLDAYPKINEDFY RTLSGGVITL S+I+ML+LF SEL Sbjct: 4 VMNRLRNLDAYPKINEDFYRRTLSGGVITLVSSIVMLILFFSEL 47