BLASTX nr result
ID: Akebia22_contig00005667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00005667 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK41721.1| unknown [Lotus japonicus] 77 2e-12 ref|XP_006836222.1| hypothetical protein AMTR_s00101p00100170 [A... 77 3e-12 ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Gly... 74 2e-11 gb|ACU24145.1| unknown [Glycine max] 74 2e-11 ref|XP_004511090.1| PREDICTED: cysteine proteinase inhibitor 12-... 74 2e-11 ref|XP_004165517.1| PREDICTED: cysteine proteinase inhibitor 12-... 74 3e-11 ref|XP_004147084.1| PREDICTED: cysteine proteinase inhibitor 12-... 74 3e-11 gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasi... 74 3e-11 ref|XP_007220532.1| hypothetical protein PRUPE_ppa010412mg [Prun... 73 4e-11 ref|XP_003628013.1| Cysteine proteinase inhibitor [Medicago trun... 73 4e-11 ref|XP_007133641.1| hypothetical protein PHAVU_011G196600g [Phas... 73 5e-11 gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] 72 1e-10 ref|NP_001237443.1| uncharacterized protein LOC100499887 precurs... 71 1e-10 gb|AAO19652.1| cysteine protease inhibitor cystatin [Malus domes... 71 1e-10 gb|AFK34375.1| unknown [Medicago truncatula] 71 2e-10 ref|XP_007010774.1| Cysteine proteinase inhibitor 12 [Theobroma ... 70 2e-10 ref|XP_004307210.1| PREDICTED: cysteine proteinase inhibitor 12-... 70 2e-10 ref|XP_004307209.1| PREDICTED: cysteine proteinase inhibitor 12-... 70 2e-10 emb|CAH60163.1| cystatin CPI-1 [Fragaria x ananassa] gi|70907503... 70 2e-10 gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa] 70 3e-10 >gb|AFK41721.1| unknown [Lotus japonicus] Length = 237 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/45 (75%), Positives = 42/45 (93%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 VI++ AKF+ILLK+KRG KEEK+KVEVHK +EG++HLNQMEQDHS Sbjct: 193 VIDDVAKFNILLKLKRGEKEEKFKVEVHKNNEGSFHLNQMEQDHS 237 >ref|XP_006836222.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda] gi|548838722|gb|ERM99075.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda] Length = 206 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 VIEE+AKFD+LLK+KRG+KEEKYKVEVHK EG+YHLN M+Q HS Sbjct: 157 VIEESAKFDMLLKLKRGNKEEKYKVEVHKNLEGSYHLNHMQQHHS 201 >ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Glycine max] gi|1944319|dbj|BAA19608.1| cysteine proteinase inhibitor [Glycine max] gi|1944342|dbj|BAA19610.1| cysteine proteinase inhibitor [Glycine max] Length = 245 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 VI++ AKF++LLKVKRG KEEK+KVEVHK ++G +HLNQMEQDHS Sbjct: 201 VIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQMEQDHS 245 >gb|ACU24145.1| unknown [Glycine max] Length = 245 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 VI++ AKF++LLKVKRG KEEK+KVEVHK ++G +HLNQMEQDHS Sbjct: 201 VIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQMEQDHS 245 >ref|XP_004511090.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cicer arietinum] Length = 247 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 VI++ A F++LLK+KRG+KEEK+KVEVHK +EGT+HLNQME DHS Sbjct: 203 VIDDVANFNLLLKLKRGAKEEKFKVEVHKNNEGTFHLNQMEADHS 247 >ref|XP_004165517.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cucumis sativus] Length = 202 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 VIE+ AKFD+LLK+KRGSKEEK+KVEVHK +EG + LNQM QDHS Sbjct: 158 VIEDAAKFDLLLKLKRGSKEEKFKVEVHKNNEGNFLLNQMVQDHS 202 >ref|XP_004147084.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cucumis sativus] Length = 249 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 VIE+ AKFD+LLK+KRGSKEEK+KVEVHK +EG + LNQM QDHS Sbjct: 205 VIEDAAKFDLLLKLKRGSKEEKFKVEVHKNNEGNFLLNQMVQDHS 249 >gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasia esculenta] Length = 205 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 V+E+ AK +LLK+KRGS+EEK+KVEVHK EGT+HLNQMEQDHS Sbjct: 157 VLEDLAKIHLLLKLKRGSREEKFKVEVHKNIEGTFHLNQMEQDHS 201 >ref|XP_007220532.1| hypothetical protein PRUPE_ppa010412mg [Prunus persica] gi|462416994|gb|EMJ21731.1| hypothetical protein PRUPE_ppa010412mg [Prunus persica] Length = 250 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 VIEE AKF++LLK+KRG KEEK+KVEVHK +EGT+ LNQME DHS Sbjct: 206 VIEEHAKFNMLLKLKRGDKEEKFKVEVHKNNEGTFKLNQMEADHS 250 >ref|XP_003628013.1| Cysteine proteinase inhibitor [Medicago truncatula] gi|355522035|gb|AET02489.1| Cysteine proteinase inhibitor [Medicago truncatula] Length = 241 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 VI++TAKF++LLKVKRG KEEK+KVEVHK EG +HLNQME D+S Sbjct: 197 VIDDTAKFNLLLKVKRGQKEEKFKVEVHKNSEGNFHLNQMEADNS 241 >ref|XP_007133641.1| hypothetical protein PHAVU_011G196600g [Phaseolus vulgaris] gi|561006641|gb|ESW05635.1| hypothetical protein PHAVU_011G196600g [Phaseolus vulgaris] Length = 246 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 V+++ AKF++LLKVKRG KEEK+KVEVHK ++G HLNQMEQDHS Sbjct: 202 VVDDFAKFNLLLKVKRGEKEEKFKVEVHKNNQGELHLNQMEQDHS 246 >gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] Length = 239 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 VI+ +AKFD++LKVKRG+KEEKYK EVHK EGT+HLNQ+E D S Sbjct: 195 VIDNSAKFDMILKVKRGTKEEKYKAEVHKNSEGTFHLNQIEPDSS 239 >ref|NP_001237443.1| uncharacterized protein LOC100499887 precursor [Glycine max] gi|255627437|gb|ACU14063.1| unknown [Glycine max] Length = 245 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 VI++ AKF++LLKVKRG KEEK+KVEVHK ++ +HLNQMEQDHS Sbjct: 201 VIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQRGFHLNQMEQDHS 245 >gb|AAO19652.1| cysteine protease inhibitor cystatin [Malus domestica] Length = 246 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 V EE AKF++LLKVKRGSKEEK+K EVHK EGT+ LNQME DHS Sbjct: 202 VAEEHAKFNMLLKVKRGSKEEKFKAEVHKNMEGTFSLNQMEADHS 246 >gb|AFK34375.1| unknown [Medicago truncatula] Length = 241 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 VI++TAKF++LLKVKRG KEEK+KVEVHK E +HLNQME D+S Sbjct: 197 VIDDTAKFNLLLKVKRGQKEEKFKVEVHKNSESNFHLNQMEADNS 241 >ref|XP_007010774.1| Cysteine proteinase inhibitor 12 [Theobroma cacao] gi|508727687|gb|EOY19584.1| Cysteine proteinase inhibitor 12 [Theobroma cacao] Length = 239 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDHS 283 V+E+ AK D+LLKVKRG KEEK+KVEVH EGT+HLN+ME DHS Sbjct: 195 VLEDFAKLDMLLKVKRGDKEEKFKVEVHHKSEGTFHLNRMEPDHS 239 >ref|XP_004307210.1| PREDICTED: cysteine proteinase inhibitor 12-like isoform 2 [Fragaria vesca subsp. vesca] Length = 230 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDH 286 V+EE AKF++LLK+KRG KEEKYKVEVHK +EG Y+LNQME +H Sbjct: 187 VMEEHAKFNMLLKLKRGDKEEKYKVEVHKNNEGAYNLNQMEVEH 230 >ref|XP_004307209.1| PREDICTED: cysteine proteinase inhibitor 12-like isoform 1 [Fragaria vesca subsp. vesca] Length = 235 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDH 286 V+EE AKF++LLK+KRG KEEKYKVEVHK +EG Y+LNQME +H Sbjct: 192 VMEEHAKFNMLLKLKRGDKEEKYKVEVHKNNEGAYNLNQMEVEH 235 >emb|CAH60163.1| cystatin CPI-1 [Fragaria x ananassa] gi|70907503|emb|CAH89260.1| Fa-CPI1 protein [Fragaria x ananassa] Length = 235 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDH 286 V+EE AKF++LLK+KRG KEEKYKVEVHK +EG Y+LNQME +H Sbjct: 192 VMEEHAKFNMLLKLKRGDKEEKYKVEVHKNNEGAYNLNQMEVEH 235 >gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa] Length = 228 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -3 Query: 417 VIEETAKFDILLKVKRGSKEEKYKVEVHKTHEGTYHLNQMEQDH 286 VIEETAKFD+LLKVKRGSKEEK+K EVHK EG + LNQM+Q++ Sbjct: 185 VIEETAKFDMLLKVKRGSKEEKFKAEVHKNLEGNFLLNQMQQEN 228