BLASTX nr result
ID: Akebia22_contig00005616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00005616 (588 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006423695.1| hypothetical protein CICLE_v10027849mg [Citr... 54 8e-07 >ref|XP_006423695.1| hypothetical protein CICLE_v10027849mg [Citrus clementina] gi|557525629|gb|ESR36935.1| hypothetical protein CICLE_v10027849mg [Citrus clementina] Length = 794 Score = 53.5 bits (127), Expect(2) = 8e-07 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = +3 Query: 288 GFVRRIQSQCGRNNMIGKEVKEDRFLKLKRMKVPDFVSWAS 410 G +RR + QC R N+ GK KED FLKL +MKVPDF W S Sbjct: 316 GCIRRSKMQCERRNITGKVGKEDGFLKLNKMKVPDFTEWTS 356 Score = 25.4 bits (54), Expect(2) = 8e-07 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 461 LIDIATFSKDGVDLYIHLAHSEL 529 LIDI +G DLYI +A+S++ Sbjct: 392 LIDIQRLPFEGTDLYIRVANSDV 414