BLASTX nr result
ID: Akebia22_contig00001250
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00001250 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003568974.1| PREDICTED: hydrophobic protein LTI6B-like [B... 76 5e-12 gb|ABK22915.1| unknown [Picea sitchensis] gi|116790796|gb|ABK257... 75 9e-12 gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Gr... 75 1e-11 ref|NP_001054591.1| Os05g0138300 [Oryza sativa Japonica Group] g... 74 2e-11 gb|EAY96485.1| hypothetical protein OsI_18385 [Oryza sativa Indi... 74 2e-11 ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citr... 74 2e-11 ref|NP_001147508.1| LOC100281117 [Zea mays] gi|195611860|gb|ACG2... 74 2e-11 gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indi... 74 2e-11 ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycin... 74 3e-11 ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like is... 74 3e-11 ref|NP_001151840.1| hydrophobic protein LTI6B [Zea mays] gi|2269... 74 3e-11 ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [C... 73 4e-11 ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like is... 73 5e-11 ref|XP_003626132.1| Hydrophobic protein LTI6A [Medicago truncatu... 73 5e-11 ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like is... 72 6e-11 ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B-like [C... 72 6e-11 dbj|BAD34658.1| plasma membrane protein 3 [Leymus chinensis] 72 6e-11 gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK4930... 72 6e-11 gb|AFI47457.1| low temperature and salt responsive protein [Medi... 72 6e-11 gb|AEJ20974.1| cold-inducible protein [Caragana jubata] 72 6e-11 >ref|XP_003568974.1| PREDICTED: hydrophobic protein LTI6B-like [Brachypodium distachyon] gi|326512942|dbj|BAK03378.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|473882221|gb|EMS48019.1| Hydrophobic protein LTI6B [Triticum urartu] Length = 55 Score = 75.9 bits (185), Expect = 5e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -2 Query: 218 MAGTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 MAGTANCIDIILAIILPP+GVFLKFGC EFWICLLLT Sbjct: 1 MAGTANCIDIILAIILPPLGVFLKFGCGHEFWICLLLT 38 >gb|ABK22915.1| unknown [Picea sitchensis] gi|116790796|gb|ABK25743.1| unknown [Picea sitchensis] gi|306015593|gb|ADM76850.1| low temprature induced-like protein [Picea sitchensis] gi|306015595|gb|ADM76851.1| low temprature induced-like protein [Picea sitchensis] gi|306015597|gb|ADM76852.1| low temprature induced-like protein [Picea sitchensis] gi|306015599|gb|ADM76853.1| low temprature induced-like protein [Picea sitchensis] gi|306015601|gb|ADM76854.1| low temprature induced-like protein [Picea sitchensis] gi|306015603|gb|ADM76855.1| low temprature induced-like protein [Picea sitchensis] gi|306015605|gb|ADM76856.1| low temprature induced-like protein [Picea sitchensis] gi|306015607|gb|ADM76857.1| low temprature induced-like protein [Picea sitchensis] gi|306015609|gb|ADM76858.1| low temprature induced-like protein [Picea sitchensis] gi|306015611|gb|ADM76859.1| low temprature induced-like protein [Picea sitchensis] gi|306015613|gb|ADM76860.1| low temprature induced-like protein [Picea sitchensis] gi|306015615|gb|ADM76861.1| low temprature induced-like protein [Picea sitchensis] gi|306015617|gb|ADM76862.1| low temprature induced-like protein [Picea sitchensis] gi|306015619|gb|ADM76863.1| low temprature induced-like protein [Picea sitchensis] gi|306015621|gb|ADM76864.1| low temprature induced-like protein [Picea sitchensis] gi|306015623|gb|ADM76865.1| low temprature induced-like protein [Picea sitchensis] gi|306015625|gb|ADM76866.1| low temprature induced-like protein [Picea sitchensis] gi|306015627|gb|ADM76867.1| low temprature induced-like protein [Picea sitchensis] gi|306015629|gb|ADM76868.1| low temprature induced-like protein [Picea sitchensis] gi|306015631|gb|ADM76869.1| low temprature induced-like protein [Picea sitchensis] gi|306015633|gb|ADM76870.1| low temprature induced-like protein [Picea sitchensis] gi|306015635|gb|ADM76871.1| low temprature induced-like protein [Picea sitchensis] gi|306015637|gb|ADM76872.1| low temprature induced-like protein [Picea sitchensis] gi|306015639|gb|ADM76873.1| low temprature induced-like protein [Picea sitchensis] gi|306015641|gb|ADM76874.1| low temprature induced-like protein [Picea sitchensis] gi|306015643|gb|ADM76875.1| low temprature induced-like protein [Picea sitchensis] gi|306015645|gb|ADM76876.1| low temprature induced-like protein [Picea sitchensis] gi|306015647|gb|ADM76877.1| low temprature induced-like protein [Picea sitchensis] gi|306015649|gb|ADM76878.1| low temprature induced-like protein [Picea sitchensis] gi|306015651|gb|ADM76879.1| low temprature induced-like protein [Picea sitchensis] gi|306015653|gb|ADM76880.1| low temprature induced-like protein [Picea sitchensis] gi|306015655|gb|ADM76881.1| low temprature induced-like protein [Picea sitchensis] gi|306015657|gb|ADM76882.1| low temprature induced-like protein [Picea sitchensis] gi|306015659|gb|ADM76883.1| low temprature induced-like protein [Picea sitchensis] gi|306015661|gb|ADM76884.1| low temprature induced-like protein [Picea sitchensis] gi|306015663|gb|ADM76885.1| low temprature induced-like protein [Picea sitchensis] gi|306015665|gb|ADM76886.1| low temprature induced-like protein [Picea sitchensis] gi|306015667|gb|ADM76887.1| low temprature induced-like protein [Picea sitchensis] gi|306015669|gb|ADM76888.1| low temprature induced-like protein [Picea sitchensis] gi|306015671|gb|ADM76889.1| low temprature induced-like protein [Picea sitchensis] gi|306015673|gb|ADM76890.1| low temprature induced-like protein [Picea sitchensis] gi|306015675|gb|ADM76891.1| low temprature induced-like protein [Picea sitchensis] gi|306015677|gb|ADM76892.1| low temprature induced-like protein [Picea sitchensis] gi|306015679|gb|ADM76893.1| low temprature induced-like protein [Picea sitchensis] gi|306015681|gb|ADM76894.1| low temprature induced-like protein [Picea sitchensis] gi|306015683|gb|ADM76895.1| low temprature induced-like protein [Picea sitchensis] Length = 59 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTANC+DIILAIILPPVGVFLKFGC EFWICLLLT Sbjct: 4 GTANCVDIILAIILPPVGVFLKFGCHAEFWICLLLT 39 >gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Group] Length = 57 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTANCIDI+LAIILPP+GVFLKFGC++EFWICLLLT Sbjct: 5 GTANCIDILLAIILPPLGVFLKFGCEMEFWICLLLT 40 >ref|NP_001054591.1| Os05g0138300 [Oryza sativa Japonica Group] gi|122169560|sp|Q0DKW8.1|LTI6B_ORYSJ RecName: Full=Hydrophobic protein LTI6B; AltName: Full=Low temperature-induced protein 6B gi|158513180|sp|A2Y075.2|LTI6B_ORYSI RecName: Full=Hydrophobic protein LTI6B; AltName: Full=Low temperature-induced protein 6B gi|21314334|gb|AAM46894.1|AF503583_1 early drought induced protein [Oryza sativa Indica Group] gi|45602865|gb|AAS72306.1| drought-induced hydrophobic protein [Oryza sativa Japonica Group] gi|47717901|gb|AAT37942.1| low temperature-induced low molecular weight integral membrane protein LTI6b [Oryza sativa Japonica Group] gi|113578142|dbj|BAF16505.1| Os05g0138300 [Oryza sativa Japonica Group] Length = 55 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 218 MAGTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 MAGTANCIDI++AIILPP+GVFLKFGC EFWICLLLT Sbjct: 1 MAGTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLT 38 >gb|EAY96485.1| hypothetical protein OsI_18385 [Oryza sativa Indica Group] gi|222630128|gb|EEE62260.1| hypothetical protein OsJ_17047 [Oryza sativa Japonica Group] Length = 92 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 218 MAGTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 MAGTANCIDI++AIILPP+GVFLKFGC EFWICLLLT Sbjct: 1 MAGTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLT 38 >ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|567871515|ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|568853386|ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis] gi|557530403|gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] gi|557530404|gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina] Length = 58 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTA CIDIILAIILPP+GVFLKFGC+VEFWICLLLT Sbjct: 5 GTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLT 40 >ref|NP_001147508.1| LOC100281117 [Zea mays] gi|195611860|gb|ACG27760.1| hydrophobic protein LTI6B [Zea mays] gi|413946837|gb|AFW79486.1| hydrophobic protein LTI6B [Zea mays] Length = 57 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTANCIDI++AIILPP+GVFLKFGC+VEFW+CLLLT Sbjct: 4 GTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLT 39 >gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indica Group] gi|222618224|gb|EEE54356.1| hypothetical protein OsJ_01354 [Oryza sativa Japonica Group] Length = 56 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTANCIDI++AIILPP+GVFLKFGC+VEFW+CLLLT Sbjct: 4 GTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLT 39 >ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycine max] Length = 104 Score = 73.6 bits (179), Expect = 3e-11 Identities = 40/65 (61%), Positives = 48/65 (73%) Frame = -2 Query: 299 SISYSLREDLFIFLVKLRFQRKE*KLKMAGTANCIDIILAIILPPVGVFLKFGCQVEFWI 120 S +Y LR+ + KLR R E K+ G A CIDI+LAIILPP+GVFLK+GCQVEFWI Sbjct: 28 SCNYFLRKKVS----KLRKSR-ETKMAGDGAATCIDILLAIILPPLGVFLKYGCQVEFWI 82 Query: 119 CLLLT 105 CL+LT Sbjct: 83 CLVLT 87 >ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Setaria italica] Length = 57 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTANC+DI++AIILPP+GVFLKFGC+VEFW+CLLLT Sbjct: 4 GTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLT 39 >ref|NP_001151840.1| hydrophobic protein LTI6B [Zea mays] gi|226958659|ref|NP_001152948.1| hydrophobic protein LTI6B [Zea mays] gi|195648282|gb|ACG43609.1| hydrophobic protein LTI6B [Zea mays] gi|195650163|gb|ACG44549.1| hydrophobic protein LTI6B [Zea mays] gi|414877124|tpg|DAA54255.1| TPA: hydrophobic protein LTI6B [Zea mays] Length = 57 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTANC+DI++AIILPP+GVFLKFGC+VEFW+CLLLT Sbjct: 4 GTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLT 39 >ref|XP_004494506.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTANCIDI+LAI+LPP+GVFLKFGC VEFWICL+LT Sbjct: 5 GTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLT 40 >ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Setaria italica] gi|514773012|ref|XP_004967636.1| PREDICTED: hydrophobic protein LTI6B-like isoform X3 [Setaria italica] Length = 56 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTANCIDI++AIILPP+GVFLKFGC+ EFWICLLLT Sbjct: 4 GTANCIDILIAIILPPLGVFLKFGCKFEFWICLLLT 39 >ref|XP_003626132.1| Hydrophobic protein LTI6A [Medicago truncatula] gi|87241339|gb|ABD33197.1| Protein of unknown function UPF0057 [Medicago truncatula] gi|355501147|gb|AES82350.1| Hydrophobic protein LTI6A [Medicago truncatula] gi|388497498|gb|AFK36815.1| unknown [Medicago truncatula] Length = 54 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTA CIDIILAIILPP+GVFLKFGC VEFWICL+LT Sbjct: 2 GTATCIDIILAIILPPLGVFLKFGCNVEFWICLILT 37 >ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like isoform X4 [Setaria italica] Length = 56 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTANC+DI++AIILPP+GVFLKFGC+ EFWICLLLT Sbjct: 4 GTANCVDILIAIILPPLGVFLKFGCKFEFWICLLLT 39 >ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 54 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTA C+DIILAIILPP+GVFLKFGC VEFWICL+LT Sbjct: 2 GTATCVDIILAIILPPLGVFLKFGCNVEFWICLILT 37 >dbj|BAD34658.1| plasma membrane protein 3 [Leymus chinensis] Length = 54 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTANCIDIILAIILPP+GVFLKFGC EFWICLLLT Sbjct: 2 GTANCIDIILAIILPPLGVFLKFGCGHEFWICLLLT 37 >gb|AFK38849.1| unknown [Lotus japonicus] gi|388522485|gb|AFK49304.1| unknown [Lotus japonicus] Length = 54 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTA C+DIILAIILPP+GVFL+FGC+VEFWICLLLT Sbjct: 2 GTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLT 37 >gb|AFI47457.1| low temperature and salt responsive protein [Medicago sativa] Length = 54 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTA C+DIILAIILPP+GVFLKFGC VEFWICL+LT Sbjct: 2 GTATCVDIILAIILPPLGVFLKFGCNVEFWICLILT 37 >gb|AEJ20974.1| cold-inducible protein [Caragana jubata] Length = 54 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 212 GTANCIDIILAIILPPVGVFLKFGCQVEFWICLLLT 105 GTA CIDIILAIILPP+GVFLKFGC VEFWICL+LT Sbjct: 2 GTATCIDIILAIILPPLGVFLKFGCNVEFWICLVLT 37