BLASTX nr result
ID: Akebia22_contig00001014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00001014 (238 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_020979111.1| hypothetical protein [Salmonella enterica] g... 67 2e-09 >ref|WP_020979111.1| hypothetical protein [Salmonella enterica] gi|532571755|gb|EQM36023.1| hypothetical protein B571_24830 [Salmonella enterica subsp. enterica serovar Typhimurium str. STm1] gi|532637315|gb|EQM57925.1| hypothetical protein B578_25935 [Salmonella enterica subsp. enterica serovar Typhimurium str. STm10] Length = 33 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 236 LQDIAAAICPTFEGYKLGSITPTNGLHTSIF 144 LQDIAAAICPTFEGYKLGSITPTNGLHTSIF Sbjct: 3 LQDIAAAICPTFEGYKLGSITPTNGLHTSIF 33