BLASTX nr result
ID: Aconitum23_contig00045282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00045282 (662 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66235.1| hypothetical protein [Beta vulgaris subsp. vulga... 58 4e-06 >emb|CCA66235.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1380 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = -2 Query: 154 NIVLWNMRGVGSRNKRRRIRKIVHKNNPWFVVIQETWREVVDLKLVRSLW 5 NI+ WN+RG+G+R KR +RK++ +NP F+ IQET +D KL+RS+W Sbjct: 3 NILSWNIRGLGARIKRSALRKMISIHNPLFITIQETKLGEIDPKLIRSIW 52