BLASTX nr result
ID: Aconitum23_contig00044872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00044872 (413 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA23369.1| hypothetical protein SOVF_025280 [Spinacia oleracea] 175 1e-41 ref|XP_010692438.1| PREDICTED: pentatricopeptide repeat-containi... 172 9e-41 ref|XP_010923573.1| PREDICTED: pentatricopeptide repeat-containi... 171 2e-40 ref|XP_007032637.1| Tetratricopeptide repeat (TPR)-like superfam... 171 3e-40 ref|XP_008785939.1| PREDICTED: pentatricopeptide repeat-containi... 169 8e-40 ref|XP_007217279.1| hypothetical protein PRUPE_ppa017633mg [Prun... 168 1e-39 ref|XP_012068951.1| PREDICTED: pentatricopeptide repeat-containi... 167 3e-39 emb|CBI22269.3| unnamed protein product [Vitis vinifera] 167 3e-39 ref|XP_002278886.1| PREDICTED: pentatricopeptide repeat-containi... 167 3e-39 ref|XP_008230824.1| PREDICTED: pentatricopeptide repeat-containi... 165 1e-38 ref|XP_002532904.1| pentatricopeptide repeat-containing protein,... 163 4e-38 ref|XP_010258202.1| PREDICTED: pentatricopeptide repeat-containi... 162 1e-37 ref|XP_012460858.1| PREDICTED: pentatricopeptide repeat-containi... 161 2e-37 ref|XP_008438067.1| PREDICTED: pentatricopeptide repeat-containi... 159 6e-37 ref|XP_008341615.1| PREDICTED: pentatricopeptide repeat-containi... 159 8e-37 ref|XP_009360575.1| PREDICTED: pentatricopeptide repeat-containi... 159 1e-36 gb|KGN56532.1| hypothetical protein Csa_3G122560 [Cucumis sativus] 157 3e-36 ref|XP_010089570.1| hypothetical protein L484_020960 [Morus nota... 155 1e-35 ref|XP_002305377.2| hypothetical protein POPTR_0004s12430g [Popu... 153 4e-35 ref|XP_004306116.1| PREDICTED: pentatricopeptide repeat-containi... 153 4e-35 >gb|KNA23369.1| hypothetical protein SOVF_025280 [Spinacia oleracea] Length = 597 Score = 175 bits (444), Expect = 1e-41 Identities = 86/124 (69%), Positives = 98/124 (79%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 MS+ R PTWVS RR LE K+SELHKCSNL LKQI AQIFK+NLH DPFV+PKL+SAFS Sbjct: 1 MSSPIRAPTWVSTRRQLELKVSELHKCSNLPHLKQIHAQIFKANLHDDPFVAPKLVSAFS 60 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC Q+ +A+N FN VQ PN+ LYN+LIRA+TQNS SQAF+ F M KN V PDNFTY Sbjct: 61 LCHQLRIAINVFNQVQFPNVHLYNSLIRAHTQNSQQSQAFTTFLDMLKNGVFPDNFTYPF 120 Query: 14 LLKA 3 LLKA Sbjct: 121 LLKA 124 >ref|XP_010692438.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Beta vulgaris subsp. vulgaris] gi|870867621|gb|KMT18490.1| hypothetical protein BVRB_2g026310 [Beta vulgaris subsp. vulgaris] Length = 587 Score = 172 bits (436), Expect = 9e-41 Identities = 83/123 (67%), Positives = 99/123 (80%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 M+T R P+WVS RR LEQKIS+LHKCSNL QLKQ+ AQI KS+LH DPFV+PKLISAFS Sbjct: 1 MTTPIRAPSWVSRRRQLEQKISQLHKCSNLSQLKQLHAQIIKSDLHHDPFVAPKLISAFS 60 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC ++ LA+N FN +Q PN+ YNTLI+A+TQNS +AF+IFF M KN V PDNFTY + Sbjct: 61 LCHKIGLAVNVFNQIQFPNVQSYNTLIKAHTQNSQSYEAFNIFFHMLKNGVYPDNFTYPV 120 Query: 14 LLK 6 LLK Sbjct: 121 LLK 123 >ref|XP_010923573.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Elaeis guineensis] Length = 601 Score = 171 bits (433), Expect = 2e-40 Identities = 81/124 (65%), Positives = 95/124 (76%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 MS R P WVSHRRL EQK++ELH CSNL +KQIQAQIFK+NLH+DPFV+PKL+SA+S Sbjct: 1 MSAPIRPPQWVSHRRLFEQKLAELHHCSNLHHVKQIQAQIFKANLHRDPFVAPKLVSAYS 60 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC + A+ F LV DPN+LLYNTLIRA+ NS S AF FF MQK+ + PDNFTY Sbjct: 61 LCRHLAPAVKAFRLVPDPNVLLYNTLIRAFAHNSQLSHAFRAFFDMQKDGIFPDNFTYPF 120 Query: 14 LLKA 3 LLKA Sbjct: 121 LLKA 124 >ref|XP_007032637.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] gi|508711666|gb|EOY03563.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 672 Score = 171 bits (432), Expect = 3e-40 Identities = 81/124 (65%), Positives = 97/124 (78%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 MS F++P+W S RRL EQK+ +LHKC+NL +KQ+QAQI + NLHQD +++PKLISAFS Sbjct: 69 MSIPFKSPSWFSTRRLFEQKLQDLHKCTNLSHIKQLQAQIIRQNLHQDLYIAPKLISAFS 128 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC Q+TLAL FN +QDPN+ LYN LIRAY QNS SQAFS FF MQ N +L DNFTY Sbjct: 129 LCRQITLALTVFNQIQDPNVHLYNNLIRAYVQNSQPSQAFSFFFDMQWNGILADNFTYTF 188 Query: 14 LLKA 3 LLKA Sbjct: 189 LLKA 192 >ref|XP_008785939.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Phoenix dactylifera] Length = 601 Score = 169 bits (428), Expect = 8e-40 Identities = 80/124 (64%), Positives = 94/124 (75%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 MS R P WVSHRRL EQK++ELH CSNL +KQIQAQIFK+NLH+DPFV+PKL+SA+S Sbjct: 1 MSVPIRPPGWVSHRRLFEQKLAELHHCSNLHHIKQIQAQIFKANLHRDPFVAPKLVSAYS 60 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC + A+ F LV DPN+LLYNTLIRA+ NS S AF F MQK+ + PDNFTY Sbjct: 61 LCRHLAPAVKAFRLVPDPNVLLYNTLIRAFAHNSQPSHAFCALFDMQKDGIFPDNFTYPF 120 Query: 14 LLKA 3 LLKA Sbjct: 121 LLKA 124 >ref|XP_007217279.1| hypothetical protein PRUPE_ppa017633mg [Prunus persica] gi|462413429|gb|EMJ18478.1| hypothetical protein PRUPE_ppa017633mg [Prunus persica] Length = 603 Score = 168 bits (426), Expect = 1e-39 Identities = 81/124 (65%), Positives = 97/124 (78%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 M R+P+WVS RRLLEQK+S+LH+C+NL +KQ+ AQI K+NLHQD +PKLI+AFS Sbjct: 1 MCVPVRSPSWVSRRRLLEQKLSDLHRCTNLSHIKQVHAQILKANLHQDLHTAPKLIAAFS 60 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC QM LA+N FN VQDPN+ LYNTLIRA+ QNS +QAF+ FF MQ N V PDNFTY Sbjct: 61 LCRQMALAVNVFNQVQDPNVHLYNTLIRAHIQNSQTTQAFATFFDMQLNGVYPDNFTYPF 120 Query: 14 LLKA 3 LLKA Sbjct: 121 LLKA 124 >ref|XP_012068951.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Jatropha curcas] Length = 598 Score = 167 bits (423), Expect = 3e-39 Identities = 79/124 (63%), Positives = 94/124 (75%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 MS A R P WVS RRL EQK+ +LHKC NL Q+K++ AQI K NLH+D +V+PKL+ AFS Sbjct: 1 MSAAIRAPAWVSTRRLFEQKLEDLHKCKNLNQVKEVHAQIIKRNLHEDLYVTPKLVLAFS 60 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 C QMTLA+N FN +QDPN+ LYNTLIRA+ QNS S AF+ FF MQKN + DNFTY Sbjct: 61 HCQQMTLAINVFNQIQDPNVQLYNTLIRAHVQNSQSSLAFAAFFDMQKNGIFADNFTYPF 120 Query: 14 LLKA 3 LLKA Sbjct: 121 LLKA 124 >emb|CBI22269.3| unnamed protein product [Vitis vinifera] Length = 509 Score = 167 bits (423), Expect = 3e-39 Identities = 81/124 (65%), Positives = 98/124 (79%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 MS R PTWVS RRLLEQKIS+LH+CS+L Q+KQI AQ+ K+NLH++ FV KLI+AFS Sbjct: 1 MSVPIRNPTWVSKRRLLEQKISDLHRCSSLNQVKQIHAQVLKANLHRESFVGQKLIAAFS 60 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC QMTLA+N FN +QDP++LLYNTLIRA+ +NS AFS+FF MQ + V DNFTY Sbjct: 61 LCRQMTLAVNVFNQIQDPDVLLYNTLIRAHVRNSEPLLAFSVFFEMQDSGVCADNFTYPF 120 Query: 14 LLKA 3 LLKA Sbjct: 121 LLKA 124 >ref|XP_002278886.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Vitis vinifera] Length = 594 Score = 167 bits (423), Expect = 3e-39 Identities = 81/124 (65%), Positives = 98/124 (79%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 MS R PTWVS RRLLEQKIS+LH+CS+L Q+KQI AQ+ K+NLH++ FV KLI+AFS Sbjct: 1 MSVPIRNPTWVSKRRLLEQKISDLHRCSSLNQVKQIHAQVLKANLHRESFVGQKLIAAFS 60 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC QMTLA+N FN +QDP++LLYNTLIRA+ +NS AFS+FF MQ + V DNFTY Sbjct: 61 LCRQMTLAVNVFNQIQDPDVLLYNTLIRAHVRNSEPLLAFSVFFEMQDSGVCADNFTYPF 120 Query: 14 LLKA 3 LLKA Sbjct: 121 LLKA 124 >ref|XP_008230824.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Prunus mume] Length = 605 Score = 165 bits (418), Expect = 1e-38 Identities = 79/124 (63%), Positives = 97/124 (78%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 M R+P+WVS RRLL+QK+S+LH+C+NL +KQ+ AQI K++LHQD +PKLI+AFS Sbjct: 3 MCVPVRSPSWVSRRRLLDQKLSDLHRCTNLSHIKQVHAQILKADLHQDLHTAPKLIAAFS 62 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC QM LA+N FN VQDPN+ LYNTLIRA+ QNS +QAF+ FF MQ N V PDNFTY Sbjct: 63 LCRQMALAVNVFNQVQDPNVHLYNTLIRAHIQNSQTTQAFATFFDMQLNGVYPDNFTYPF 122 Query: 14 LLKA 3 LLKA Sbjct: 123 LLKA 126 >ref|XP_002532904.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527338|gb|EEF29484.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 604 Score = 163 bits (413), Expect = 4e-38 Identities = 77/127 (60%), Positives = 95/127 (74%) Frame = -1 Query: 383 PITMSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLIS 204 P+ MS R PTWVS RRL E+K+ +LHKC++ +K++ AQI K NLH D +V+PKLIS Sbjct: 4 PVRMSLPTRAPTWVSTRRLFEEKLQDLHKCTDFNHIKEVHAQIIKRNLHNDLYVAPKLIS 63 Query: 203 AFSLCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFT 24 AFSLC QM LA+N FN +QDPN+ LYNTLIRA+ QNS +AF+ FF MQKN + DNFT Sbjct: 64 AFSLCHQMNLAVNVFNQIQDPNVHLYNTLIRAHVQNSQSLKAFATFFDMQKNGLFADNFT 123 Query: 23 YQILLKA 3 Y LLKA Sbjct: 124 YPFLLKA 130 >ref|XP_010258202.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Nelumbo nucifera] Length = 606 Score = 162 bits (409), Expect = 1e-37 Identities = 86/124 (69%), Positives = 94/124 (75%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 MSTA RTPTWVS RRLLEQK+SE CSN LKQIQAQ+FK+NLHQDPF++ LI AFS Sbjct: 13 MSTAIRTPTWVSKRRLLEQKLSE---CSNPIHLKQIQAQMFKANLHQDPFMARTLIQAFS 69 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 Q+ LA+N FN +Q PN LLYNTLIRA TQN AFSIFF MQKN V PDNFTY Sbjct: 70 SSRQVMLAVNVFNQIQQPNTLLYNTLIRACTQNFQSFLAFSIFFDMQKNGVFPDNFTYSF 129 Query: 14 LLKA 3 LLKA Sbjct: 130 LLKA 133 >ref|XP_012460858.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Gossypium raimondii] gi|763808768|gb|KJB75670.1| hypothetical protein B456_012G051200 [Gossypium raimondii] Length = 617 Score = 161 bits (408), Expect = 2e-37 Identities = 78/124 (62%), Positives = 95/124 (76%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 MS ++P+W S RRL EQK+ +LHKC+NL +KQ+QAQI K NLH D +++PKLISAFS Sbjct: 17 MSIPLKSPSWSSTRRLFEQKLQDLHKCNNLSHVKQLQAQIIKQNLHHDLYIAPKLISAFS 76 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC Q+TLALN F+ ++ PN+ LYNTLIRA QNS SQAFS +F MQ N VL DNFTY Sbjct: 77 LCRQLTLALNVFSQIELPNVHLYNTLIRACVQNSQPSQAFSFYFEMQGNGVLADNFTYPF 136 Query: 14 LLKA 3 LLKA Sbjct: 137 LLKA 140 >ref|XP_008438067.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Cucumis melo] Length = 601 Score = 159 bits (403), Expect = 6e-37 Identities = 78/122 (63%), Positives = 94/122 (77%) Frame = -1 Query: 371 STAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFSL 192 S RTP+W S R+L EQK++ELHKC++L Q+KQ+ AQI KSNLH D FV PKLISAFSL Sbjct: 5 SVPIRTPSWFSTRKLFEQKLAELHKCTDLNQVKQLHAQILKSNLHVDLFVVPKLISAFSL 64 Query: 191 CLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQIL 12 C QM LA NTFN VQ PN+ LYNT+IRA++ NS SQAF+ FF MQ++ PDNFT+ L Sbjct: 65 CRQMLLATNTFNQVQYPNVHLYNTMIRAHSHNSQPSQAFATFFAMQRDGFYPDNFTFPFL 124 Query: 11 LK 6 LK Sbjct: 125 LK 126 >ref|XP_008341615.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Malus domestica] Length = 605 Score = 159 bits (402), Expect = 8e-37 Identities = 76/124 (61%), Positives = 95/124 (76%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 M R+P+WVS RR+L+QK+S+LH+C+NL +KQ+ AQI K++LHQD +PKLI+AFS Sbjct: 3 MCVPVRSPSWVSRRRILDQKLSDLHRCTNLSHVKQVHAQILKADLHQDIHTAPKLIAAFS 62 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC QM LA+N FN + PN+ LYNTLIRA+ QNS SQAF+ FF MQ N V PDNFTY Sbjct: 63 LCRQMALAVNVFNQIDYPNVHLYNTLIRAHIQNSQTSQAFAAFFDMQINGVYPDNFTYPF 122 Query: 14 LLKA 3 LLKA Sbjct: 123 LLKA 126 >ref|XP_009360575.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Pyrus x bretschneideri] Length = 605 Score = 159 bits (401), Expect = 1e-36 Identities = 76/124 (61%), Positives = 95/124 (76%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 M R+P+WVS RR+L+QK+S+LH+C+NL +KQ+ AQI K++LHQD +PKLI+AFS Sbjct: 3 MCVPVRSPSWVSRRRILDQKLSDLHRCTNLSHIKQVHAQILKADLHQDIHSAPKLIAAFS 62 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC QM LA+N FN + PN+ LYNTLIRA+ QNS SQAF+ FF MQ N V PDNFTY Sbjct: 63 LCRQMALAVNVFNQIDYPNVHLYNTLIRAHIQNSQTSQAFAAFFDMQINGVYPDNFTYPF 122 Query: 14 LLKA 3 LLKA Sbjct: 123 LLKA 126 >gb|KGN56532.1| hypothetical protein Csa_3G122560 [Cucumis sativus] Length = 1217 Score = 157 bits (397), Expect = 3e-36 Identities = 78/122 (63%), Positives = 93/122 (76%) Frame = -1 Query: 371 STAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFSL 192 S RTP+W S R+LLEQK+S+LHKC+NL Q+KQ+ AQI KSNLH D FV PKLISAFSL Sbjct: 5 SVPIRTPSWFSTRKLLEQKLSDLHKCTNLNQVKQLHAQILKSNLHVDLFVVPKLISAFSL 64 Query: 191 CLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQIL 12 C QM LA N FN VQ PN+ LYNT+IRA++ NS SQAF+ FF MQ++ DNFT+ L Sbjct: 65 CRQMLLATNAFNQVQYPNVHLYNTMIRAHSHNSQPSQAFATFFAMQRDGHYADNFTFPFL 124 Query: 11 LK 6 LK Sbjct: 125 LK 126 >ref|XP_010089570.1| hypothetical protein L484_020960 [Morus notabilis] gi|587847708|gb|EXB38041.1| hypothetical protein L484_020960 [Morus notabilis] Length = 599 Score = 155 bits (391), Expect = 1e-35 Identities = 71/124 (57%), Positives = 94/124 (75%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 M R P WVS R+LLEQK++ LHKC+N+ +KQ+ AQI ++NLH DPFV+PKLI+AFS Sbjct: 3 MCVPVRKPGWVSPRKLLEQKLTHLHKCANILHIKQLHAQIIRANLHLDPFVAPKLIAAFS 62 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 LC Q+ LA+N F+ + +PN+ ++N +IRA+TQNS QAF+ FF MQ N V PDN+TY Sbjct: 63 LCRQIALAVNVFDQIPEPNVHVFNAMIRAHTQNSQGPQAFAAFFNMQSNGVSPDNYTYSF 122 Query: 14 LLKA 3 LLKA Sbjct: 123 LLKA 126 >ref|XP_002305377.2| hypothetical protein POPTR_0004s12430g [Populus trichocarpa] gi|550340897|gb|EEE85888.2| hypothetical protein POPTR_0004s12430g [Populus trichocarpa] Length = 604 Score = 153 bits (387), Expect = 4e-35 Identities = 73/124 (58%), Positives = 89/124 (71%) Frame = -1 Query: 374 MSTAFRTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFS 195 +S R PTWVS RR+ +QK+ +LHKC+NL +KQ+ AQI K NLHQD +V+PKLISAFS Sbjct: 7 ISVPIRAPTWVSTRRIFQQKLQDLHKCTNLNHIKQVHAQILKQNLHQDLYVAPKLISAFS 66 Query: 194 LCLQMTLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQI 15 L +MTLA+N F + DPN+ LYNT IRA QNS AF FF MQ+N + DNFTY Sbjct: 67 LSQEMTLAINVFKQIPDPNVHLYNTFIRACVQNSHSLLAFETFFEMQRNGLFADNFTYPF 126 Query: 14 LLKA 3 LLKA Sbjct: 127 LLKA 130 >ref|XP_004306116.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 [Fragaria vesca subsp. vesca] Length = 605 Score = 153 bits (387), Expect = 4e-35 Identities = 72/119 (60%), Positives = 91/119 (76%) Frame = -1 Query: 359 RTPTWVSHRRLLEQKISELHKCSNLQQLKQIQAQIFKSNLHQDPFVSPKLISAFSLCLQM 180 R+P WVS RRLL+Q +S+LH+C+NL +KQ+ AQI K++LHQDP +PKLI+AFSLC M Sbjct: 8 RSPGWVSRRRLLDQNLSDLHRCTNLAHIKQVHAQILKAHLHQDPHTAPKLIAAFSLCRHM 67 Query: 179 TLALNTFNLVQDPNILLYNTLIRAYTQNSLHSQAFSIFFRMQKNSVLPDNFTYQILLKA 3 LA+N FN V PN+ LYNTLIRA+ N+ SQAF+ FF MQ + V PDNFT+ LLKA Sbjct: 68 ALAVNVFNQVHHPNVHLYNTLIRAHIHNNQPSQAFAAFFDMQAHGVYPDNFTFPFLLKA 126