BLASTX nr result
ID: Aconitum23_contig00042159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00042159 (380 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW80797.1| hypothetical protein EUGRSUZ_C02171, partial [Euc... 76 9e-12 emb|CDP19323.1| unnamed protein product [Coffea canephora] 70 8e-10 ref|XP_010112427.1| putative mitochondrial protein [Morus notabi... 66 9e-09 ref|YP_002608374.1| orf102 [Vitis vinifera] gi|209954171|emb|CAQ... 59 2e-06 ref|NP_085566.1| hypothetical protein ArthMp044 [Arabidopsis tha... 57 5e-06 >gb|KCW80797.1| hypothetical protein EUGRSUZ_C02171, partial [Eucalyptus grandis] Length = 88 Score = 76.3 bits (186), Expect = 9e-12 Identities = 41/52 (78%), Positives = 43/52 (82%) Frame = -2 Query: 157 MIVTTLQILFSLIRYVTETKLFRSVSVFFSDSEDEPADPNIIYEEPDD*ASS 2 MIV LQILF LIRYVTET RSVS+FFSDSE EPADPN+IYEE DD ASS Sbjct: 1 MIVRALQILFHLIRYVTET--IRSVSIFFSDSEGEPADPNVIYEELDDEASS 50 >emb|CDP19323.1| unnamed protein product [Coffea canephora] Length = 136 Score = 69.7 bits (169), Expect = 8e-10 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -3 Query: 114 MSLKPSYSVLSLFSFRIPRMSRPILTSFMRSRTTKPPP 1 MSLK S SVLSLFSFRIPRMSRPILTSFMRSR TKPPP Sbjct: 1 MSLKESDSVLSLFSFRIPRMSRPILTSFMRSRVTKPPP 38 >ref|XP_010112427.1| putative mitochondrial protein [Morus notabilis] gi|587947246|gb|EXC33548.1| putative mitochondrial protein [Morus notabilis] Length = 478 Score = 66.2 bits (160), Expect = 9e-09 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -2 Query: 124 LIRYVTETKLFRSVSVFFSDSEDEPADPNIIYEEPDD*ASS 2 LIRYVTET RSVSV FSDSEDEPADPNIIYEEP+D ASS Sbjct: 117 LIRYVTET--IRSVSVLFSDSEDEPADPNIIYEEPNDEASS 155 >ref|YP_002608374.1| orf102 [Vitis vinifera] gi|209954171|emb|CAQ77618.1| orf102 [Vitis vinifera] gi|239764768|gb|ACS15237.1| ORF102 [Vitis vinifera] Length = 101 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/38 (84%), Positives = 32/38 (84%) Frame = -3 Query: 114 MSLKPSYSVLSLFSFRIPRMSRPILTSFMRSRTTKPPP 1 MSLK S VLSL FRIPRMSRPILTSFMRS TTKPPP Sbjct: 1 MSLKQS--VLSLLYFRIPRMSRPILTSFMRSWTTKPPP 36 >ref|NP_085566.1| hypothetical protein ArthMp044 [Arabidopsis thaliana] gi|45477063|sp|P92544.1|M1130_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg01130; AltName: Full=ORF106f gi|1785767|emb|CAA69797.1| unnamed protein product [Arabidopsis thaliana] Length = 106 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -2 Query: 157 MIVTTLQILFSLIRYVTETKLFRSVSVFFSDSEDEPAD 44 M+VT LQILFSLIRYVTET RSVSV FSDSEDEP D Sbjct: 1 MMVTALQILFSLIRYVTET--IRSVSVLFSDSEDEPDD 36