BLASTX nr result
ID: Aconitum23_contig00038970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00038970 (319 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004293229.1| PREDICTED: putative pentatricopeptide repeat... 80 8e-13 ref|XP_006856131.1| PREDICTED: putative pentatricopeptide repeat... 72 2e-10 ref|XP_006473439.1| PREDICTED: putative pentatricopeptide repeat... 70 5e-10 ref|XP_006434922.1| hypothetical protein CICLE_v10003562mg [Citr... 70 6e-10 ref|XP_010106047.1| hypothetical protein L484_021225 [Morus nota... 69 1e-09 ref|XP_009341232.1| PREDICTED: putative pentatricopeptide repeat... 67 5e-09 ref|XP_008339434.1| PREDICTED: putative pentatricopeptide repeat... 67 5e-09 ref|XP_012445273.1| PREDICTED: putative pentatricopeptide repeat... 67 7e-09 gb|KJB58338.1| hypothetical protein B456_009G205400 [Gossypium r... 67 7e-09 ref|XP_010274884.1| PREDICTED: putative pentatricopeptide repeat... 67 7e-09 ref|XP_002510334.1| pentatricopeptide repeat-containing protein,... 67 7e-09 ref|XP_007017448.1| Pentatricopeptide repeat superfamily protein... 67 7e-09 ref|XP_012071770.1| PREDICTED: putative pentatricopeptide repeat... 62 2e-07 ref|XP_008218639.1| PREDICTED: putative pentatricopeptide repeat... 60 5e-07 ref|XP_011031234.1| PREDICTED: putative pentatricopeptide repeat... 59 1e-06 ref|XP_006375054.1| hypothetical protein POPTR_0014s03970g [Popu... 58 2e-06 ref|XP_011652402.1| PREDICTED: putative pentatricopeptide repeat... 57 4e-06 ref|XP_008466623.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 57 4e-06 ref|XP_009412297.1| PREDICTED: putative pentatricopeptide repeat... 57 7e-06 >ref|XP_004293229.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Fragaria vesca subsp. vesca] gi|764546592|ref|XP_011459578.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Fragaria vesca subsp. vesca] gi|764546598|ref|XP_011459579.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Fragaria vesca subsp. vesca] gi|764546603|ref|XP_011459580.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Fragaria vesca subsp. vesca] Length = 884 Score = 79.7 bits (195), Expect = 8e-13 Identities = 37/62 (59%), Positives = 49/62 (79%) Frame = -2 Query: 189 FHQTKSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHFDYSDHLLSSV 10 FH+ + LH SR +HWKP+ EYKLT +L+ RI R+LVLQRY A+N+L F++SD LL+SV Sbjct: 7 FHR-RPLHVSRTAVHWKPRDEYKLTRPELLDRISRLLVLQRYDALNNLSFEFSDQLLNSV 65 Query: 9 LR 4 LR Sbjct: 66 LR 67 >ref|XP_006856131.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Amborella trichopoda] gi|548859990|gb|ERN17598.1| hypothetical protein AMTR_s00059p00156460 [Amborella trichopoda] Length = 962 Score = 71.6 bits (174), Expect = 2e-10 Identities = 38/76 (50%), Positives = 47/76 (61%), Gaps = 3/76 (3%) Frame = -2 Query: 219 MLRYSSTI---SFFHQTKSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINH 49 M RY S I S F KS+HT+ LL KP H LT + L+ +CRIL+L R AI+H Sbjct: 17 MSRYFSLITPLSLFPAAKSIHTTTTLLQRKPNHGPPLTQTQLIETLCRILILNRLEAISH 76 Query: 48 LHFDYSDHLLSSVLRK 1 L FD+SD L+ VLRK Sbjct: 77 LSFDFSDELVDGVLRK 92 >ref|XP_006473439.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X1 [Citrus sinensis] gi|568838908|ref|XP_006473440.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X2 [Citrus sinensis] gi|568838910|ref|XP_006473441.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X3 [Citrus sinensis] gi|568838912|ref|XP_006473442.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X4 [Citrus sinensis] gi|568838914|ref|XP_006473443.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X5 [Citrus sinensis] gi|568838916|ref|XP_006473444.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X6 [Citrus sinensis] gi|568838918|ref|XP_006473445.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290-like isoform X7 [Citrus sinensis] Length = 955 Score = 70.5 bits (171), Expect = 5e-10 Identities = 33/57 (57%), Positives = 45/57 (78%) Frame = -2 Query: 171 LHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHFDYSDHLLSSVLRK 1 LH SR L HWKP+HEY+L+ +L+ RI R+LVL R+ A+++L FD+SD LL SVL+K Sbjct: 22 LHVSRSL-HWKPRHEYRLSQPELLDRITRLLVLGRFDAVDNLSFDFSDDLLDSVLQK 77 >ref|XP_006434922.1| hypothetical protein CICLE_v10003562mg [Citrus clementina] gi|557537044|gb|ESR48162.1| hypothetical protein CICLE_v10003562mg [Citrus clementina] Length = 955 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/57 (57%), Positives = 44/57 (77%) Frame = -2 Query: 171 LHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHFDYSDHLLSSVLRK 1 LH SR L HWKP+HEY+L+ +L+ RI R+LVL R+ A+++L FD+SD LL SVL K Sbjct: 22 LHVSRSL-HWKPRHEYRLSRPELLDRITRLLVLGRFDAVDNLSFDFSDDLLDSVLHK 77 >ref|XP_010106047.1| hypothetical protein L484_021225 [Morus notabilis] gi|587919863|gb|EXC07317.1| hypothetical protein L484_021225 [Morus notabilis] Length = 921 Score = 68.9 bits (167), Expect = 1e-09 Identities = 36/59 (61%), Positives = 43/59 (72%) Frame = -2 Query: 177 KSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHFDYSDHLLSSVLRK 1 +SLH SR L WK + EYKLT +LV RI R+LVLQR+ AI+ L F +SD LL SVLRK Sbjct: 19 RSLHVSRPL-QWKLRDEYKLTRPELVDRISRLLVLQRFNAIDELSFQFSDELLDSVLRK 76 >ref|XP_009341232.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Pyrus x bretschneideri] gi|694427189|ref|XP_009341233.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Pyrus x bretschneideri] gi|694427192|ref|XP_009341234.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Pyrus x bretschneideri] gi|694427194|ref|XP_009341235.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Pyrus x bretschneideri] gi|694427197|ref|XP_009341236.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Pyrus x bretschneideri] gi|694427199|ref|XP_009341237.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Pyrus x bretschneideri] Length = 893 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/59 (57%), Positives = 43/59 (72%) Frame = -2 Query: 177 KSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHFDYSDHLLSSVLRK 1 +SLH SR HWK + EYKLT L RI R+L+LQRY A++ L FD+SD LLS+VLR+ Sbjct: 8 RSLHVSRTP-HWKLRDEYKLTRPQLHDRISRLLLLQRYDALHQLSFDFSDRLLSTVLRQ 65 >ref|XP_008339434.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Malus domestica] gi|658008480|ref|XP_008339435.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Malus domestica] gi|658008482|ref|XP_008339436.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Malus domestica] gi|658008484|ref|XP_008339437.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Malus domestica] gi|658008486|ref|XP_008339438.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Malus domestica] Length = 894 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/59 (57%), Positives = 43/59 (72%) Frame = -2 Query: 177 KSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHFDYSDHLLSSVLRK 1 +SLH SR HWK + EYKLT L RI R+L+LQRY A++ L FD+SD LLS+VLR+ Sbjct: 8 RSLHVSRTP-HWKLRDEYKLTRPQLHDRISRLLLLQRYDALHQLSFDFSDRLLSTVLRQ 65 >ref|XP_012445273.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Gossypium raimondii] Length = 881 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = -2 Query: 186 HQTKSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHFDYSDHLLSSVL 7 H KS H S L +WK + EYKLT +++SRI R+L+L RY A+N L FD+SD LL SVL Sbjct: 18 HPLKSFHASSPL-YWKLRDEYKLTRPEILSRITRLLILGRYNALNDLSFDFSDDLLDSVL 76 Query: 6 R 4 + Sbjct: 77 Q 77 >gb|KJB58338.1| hypothetical protein B456_009G205400 [Gossypium raimondii] Length = 926 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = -2 Query: 186 HQTKSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHFDYSDHLLSSVL 7 H KS H S L +WK + EYKLT +++SRI R+L+L RY A+N L FD+SD LL SVL Sbjct: 18 HPLKSFHASSPL-YWKLRDEYKLTRPEILSRITRLLILGRYNALNDLSFDFSDDLLDSVL 76 Query: 6 R 4 + Sbjct: 77 Q 77 >ref|XP_010274884.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Nelumbo nucifera] gi|720060458|ref|XP_010274885.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Nelumbo nucifera] gi|720060461|ref|XP_010274886.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Nelumbo nucifera] Length = 955 Score = 66.6 bits (161), Expect = 7e-09 Identities = 38/79 (48%), Positives = 49/79 (62%), Gaps = 6/79 (7%) Frame = -2 Query: 219 MLRYSST------ISFFHQTKSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTA 58 MLRYSS + F++ +S+H SRVL WK + E KL +L+ RICRIL+L R A Sbjct: 1 MLRYSSASRLPHLLCHFYRKESIHGSRVLW-WKVRDELKLNQPELLERICRILILGRLKA 59 Query: 57 INHLHFDYSDHLLSSVLRK 1 I L F Y+D +L VLRK Sbjct: 60 IPQLSFGYTDEILDGVLRK 78 >ref|XP_002510334.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551035|gb|EEF52521.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 947 Score = 66.6 bits (161), Expect = 7e-09 Identities = 36/73 (49%), Positives = 46/73 (63%) Frame = -2 Query: 219 MLRYSSTISFFHQTKSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHF 40 MLRYS + SL R HWKP+HE KLT +L+ RI R+LVL RY A+ L+F Sbjct: 1 MLRYSPIFP----SLSLLRLRKSYHWKPRHESKLTRPELIDRISRLLVLGRYHALKDLNF 56 Query: 39 DYSDHLLSSVLRK 1 +SD++L SVL K Sbjct: 57 QFSDYILDSVLLK 69 >ref|XP_007017448.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508722776|gb|EOY14673.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 937 Score = 66.6 bits (161), Expect = 7e-09 Identities = 38/78 (48%), Positives = 50/78 (64%), Gaps = 6/78 (7%) Frame = -2 Query: 219 MLRY-----SSTISFFHQT-KSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTA 58 MLRY S S+ H+ +S H S L HWK + E+ +T DL+SRI R+L+L RY A Sbjct: 1 MLRYFRLHSPSLHSYVHRPLQSFHASSPL-HWKLREEFNITRPDLISRITRLLILGRYNA 59 Query: 57 INHLHFDYSDHLLSSVLR 4 +N L FD+S+ LL SVLR Sbjct: 60 LNDLSFDFSNELLDSVLR 77 >ref|XP_012071770.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Jatropha curcas] gi|802592790|ref|XP_012071771.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Jatropha curcas] gi|643731120|gb|KDP38458.1| hypothetical protein JCGZ_04383 [Jatropha curcas] Length = 950 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = -2 Query: 150 LHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHFDYSDHLLSSVLRK 1 LHWKP+HE KLT +L+ RI R+L+L RY A++ L+F +SD LL SV K Sbjct: 23 LHWKPRHESKLTRPELIDRISRLLILGRYHALSDLNFVFSDDLLDSVFLK 72 >ref|XP_008218639.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Prunus mume] Length = 893 Score = 60.5 bits (145), Expect = 5e-07 Identities = 32/61 (52%), Positives = 44/61 (72%), Gaps = 2/61 (3%) Frame = -2 Query: 177 KSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAIN--HLHFDYSDHLLSSVLR 4 +SLH SR L +WK + EYKLT +L RI +LVLQRY A++ L F++SD LL+++LR Sbjct: 8 RSLHVSRTL-NWKLRDEYKLTRPELQDRISNLLVLQRYDALDKLKLSFEFSDQLLNTILR 66 Query: 3 K 1 K Sbjct: 67 K 67 >ref|XP_011031234.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Populus euphratica] gi|743787575|ref|XP_011031243.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Populus euphratica] gi|743787579|ref|XP_011031250.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Populus euphratica] gi|743787582|ref|XP_011031258.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Populus euphratica] gi|743787586|ref|XP_011031268.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Populus euphratica] gi|743787590|ref|XP_011031276.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Populus euphratica] gi|743787593|ref|XP_011031285.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Populus euphratica] Length = 948 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/73 (42%), Positives = 47/73 (64%) Frame = -2 Query: 219 MLRYSSTISFFHQTKSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHF 40 MLR+S S SL S +HWKP+HE L+ +L RI R+L+L+R+ A+ +L+F Sbjct: 1 MLRHSPIPSPSPLLSSLRKS---IHWKPRHESNLSRPELHERISRLLILRRFDALENLNF 57 Query: 39 DYSDHLLSSVLRK 1 +SD+L+ S+L K Sbjct: 58 HFSDNLVDSILVK 70 >ref|XP_006375054.1| hypothetical protein POPTR_0014s03970g [Populus trichocarpa] gi|550323368|gb|ERP52851.1| hypothetical protein POPTR_0014s03970g [Populus trichocarpa] Length = 948 Score = 58.2 bits (139), Expect = 2e-06 Identities = 31/73 (42%), Positives = 46/73 (63%) Frame = -2 Query: 219 MLRYSSTISFFHQTKSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHF 40 MLR+S S SL S +HWKP+HE L+ +L RI R+L+L+R+ A+ +L+F Sbjct: 1 MLRHSPIPSPSPLLSSLRKS---IHWKPRHESNLSRPELHERISRLLILRRFDALENLNF 57 Query: 39 DYSDHLLSSVLRK 1 +SD L+ S+L K Sbjct: 58 HFSDSLVDSILVK 70 >ref|XP_011652402.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Cucumis sativus] Length = 912 Score = 57.4 bits (137), Expect = 4e-06 Identities = 36/77 (46%), Positives = 46/77 (59%), Gaps = 5/77 (6%) Frame = -2 Query: 219 MLRYSST-----ISFFHQTKSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAI 55 ML YSST S SLH SR L WK + E KL+ DLV RI R+LVL+R+ A+ Sbjct: 1 MLWYSSTPIHRLYSHLLLRNSLHVSRTL-QWKFRDELKLSQPDLVDRISRLLVLRRFDAL 59 Query: 54 NHLHFDYSDHLLSSVLR 4 +L F +S+ L+ VLR Sbjct: 60 ANLSFSFSNELMDLVLR 76 >ref|XP_008466623.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At1g19290 [Cucumis melo] Length = 912 Score = 57.4 bits (137), Expect = 4e-06 Identities = 36/77 (46%), Positives = 46/77 (59%), Gaps = 5/77 (6%) Frame = -2 Query: 219 MLRYSST-----ISFFHQTKSLHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAI 55 ML YSST S+ SLH SR L WK E KL+ DLV RI R+LVL+R+ A+ Sbjct: 1 MLWYSSTSIHRLYSYLLLRNSLHVSRTL-QWKFGDELKLSQPDLVDRISRLLVLRRFDAL 59 Query: 54 NHLHFDYSDHLLSSVLR 4 +L F +S+ L+ VLR Sbjct: 60 ANLSFSFSNELMDLVLR 76 >ref|XP_009412297.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Musa acuminata subsp. malaccensis] gi|695048765|ref|XP_009412298.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g19290 [Musa acuminata subsp. malaccensis] Length = 966 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/55 (47%), Positives = 38/55 (69%) Frame = -2 Query: 171 LHTSRVLLHWKPKHEYKLTHSDLVSRICRILVLQRYTAINHLHFDYSDHLLSSVL 7 +H++ VLL W+ + ++ ++LV RICRIL LQR+ AI L FD+SD +L VL Sbjct: 25 IHSAPVLLQWRANSQTGISRTELVDRICRILTLQRFHAIPKLPFDFSDGILDDVL 79