BLASTX nr result
ID: Aconitum23_contig00037453
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Aconitum23_contig00037453 (587 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008451623.1| PREDICTED: BTB/POZ domain-containing protein... 58 4e-06 ref|XP_004136051.1| PREDICTED: BTB/POZ domain-containing protein... 58 4e-06 >ref|XP_008451623.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform X1 [Cucumis melo] Length = 674 Score = 57.8 bits (138), Expect = 4e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 296 VFKDMGVATFAELKPGMSGKRAFRPSSSIRHAVEW 400 VF MGV T AELKP +SGKR+FRPSSSIRHA EW Sbjct: 39 VFFRMGVVTVAELKPSISGKRSFRPSSSIRHATEW 73 >ref|XP_004136051.1| PREDICTED: BTB/POZ domain-containing protein At1g03010 isoform X1 [Cucumis sativus] gi|700189662|gb|KGN44895.1| hypothetical protein Csa_7G394640 [Cucumis sativus] Length = 675 Score = 57.8 bits (138), Expect = 4e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 296 VFKDMGVATFAELKPGMSGKRAFRPSSSIRHAVEW 400 VF MGV T AELKP +SGKR+FRPSSSIRHA EW Sbjct: 40 VFFRMGVVTVAELKPSISGKRSFRPSSSIRHATEW 74